The URL can be used to link to this page

Agenda and PacketAGENDA CHANHASSEN CITY COUNCIL TUESDAY, NOVEMBER 12, 2019 CHANHASSEN CITY HALL, 7700 MARKET BOULEVARD A.5:00 P.M. WORK SESSION Note: Work sessions are open to the public.If the City Council does not complete the work session items in the time allotted, the remaining items will be considered after the regular agenda. 1.Distribute City Manager's Work Plan and Discuss Schedule for Performance Evaluation 2.Discuss Metropolitan Council Bid for City Portion Cost of Sewer Lining (Project #1902) 3.Discussion of 2020 Budget 4.Key Financial Strategy: Discussion of Utility Fund Fees B.7:00 P.M. CALL TO ORDER (Pledge of Allegiance) C.PUBLIC ANNOUNCEMENTS D.CONSENT AGENDA All items listed under the Consent Agenda are considered to be routine by the city council and will be considered as one motion. There will be no separate discussion of these items. If discussion is desired, that item will be removed from the Consent Agenda and considered separately. City council action is based on the staff recommendation for each item. Refer to the council packet for each staff report. 1.Approve City Council Minutes dated October 28, 2019 2.Receive Planning Commission Minutes dated October 15, 2019 3.Resolution 2019XX: Authorize Condemnation Offers for CSAH 101 RightofWay Acquisition 4.Resolution 2019XX: Approve Transfer of Remaining 2018 General Fund Surplus 5.Resolution 2019XX: Approval of Plans & Specifications and Authorize Advertisement for Bids for the Powers Boulevard/Lake Lucy Road Pedestrian Project; Approve Amendment to Consulting Engineering Contract 6.Approve Pioneer Pass Park Recreational Skating Rink 7.Resolution 2019XX: Accept Bids Procured through Construction Cooperation Agreement with the Metropolitan Council Environmental Services and Award Contract for Construction of Cured InPlace Pipe Project #1902 AGENDACHANHASSEN CITY COUNCILTUESDAY, NOVEMBER 12, 2019CHANHASSEN CITY HALL, 7700 MARKET BOULEVARDA.5:00 P.M. WORK SESSIONNote: Work sessions are open to the public.If the City Council does not complete the worksession items in the time allotted, the remaining items will be considered after the regularagenda.1.Distribute City Manager's Work Plan and Discuss Schedule for Performance Evaluation2.Discuss Metropolitan Council Bid for City Portion Cost of Sewer Lining (Project #1902)3.Discussion of 2020 Budget4.Key Financial Strategy: Discussion of Utility Fund FeesB.7:00 P.M. CALL TO ORDER (Pledge of Allegiance)C.PUBLIC ANNOUNCEMENTSD.CONSENT AGENDAAll items listed under the Consent Agenda are considered to be routine by the city council andwill be considered as one motion. There will be no separate discussion of these items. Ifdiscussion is desired, that item will be removed from the Consent Agenda and consideredseparately. City council action is based on the staff recommendation for each item. Refer to thecouncil packet for each staff report.1.Approve City Council Minutes dated October 28, 20192.Receive Planning Commission Minutes dated October 15, 20193.Resolution 2019XX: Authorize Condemnation Offers for CSAH 101 RightofWayAcquisition4.Resolution 2019XX: Approve Transfer of Remaining 2018 General Fund Surplus5.Resolution 2019XX: Approval of Plans & Specifications and Authorize Advertisementfor Bids for the Powers Boulevard/Lake Lucy Road Pedestrian Project; ApproveAmendment to Consulting Engineering Contract6.Approve Pioneer Pass Park Recreational Skating Rink7.Resolution 2019XX: Accept Bids Procured through Construction Cooperation Agreement with the Metropolitan Council Environmental Services and Award Contract for Construction of Cured InPlace Pipe Project #1902 E.VISITOR PRESENTATIONS Visitor Presentations requesting a response or action from the City Council must complete and submit the Citizen Action Request Form (see VISITOR GUIDELINES at the end of this agenda) F.OLD BUSINESS G.PUBLIC HEARINGS H.NEW BUSINESS I.COUNCIL PRESENTATIONS J.ADMINISTRATIVE PRESENTATIONS K.CORRESPONDENCE DISCUSSION 1.Review of Claims Paid 11122019 2.Building Permit Data as of 11012019 3.2019 Building Permit Activity through 1112019 L.ADJOURNMENT M.GUIDELINES GUIDELINES FOR VISITOR PRESENTATIONS Welcome to the Chanhassen City Council Meeting. In the interest of open communications, the Chanhassen City Council wishes to provide an opportunity for the public to address the City Council. That opportunity is provided at every regular City Council meeting during Visitor Presentations. Anyone seeking a response or action from the City Council following their presentation is required to complete and submit a Citizen Action Request Form. An online form is available at https://www.ci.chanhassen.mn.us/action or paper forms are available in the city council chambers prior to the meeting. Anyone indicating a desire to speak during Visitor Presentations will be acknowledged by the Mayor. When called upon to speak, state your name, address, and topic. All remarks shall be addressed to the City Council as a whole, not to any specific member(s) or to any person who is not a member of the City Council. If there are a number of individuals present to speak on the same topic, please designate a spokesperson that can summarize the issue. Limit your comments to five minutes. Additional time may be granted at the discretion of the Mayor. If you have written comments, provide a copy to the Council. During Visitor Presentations, the Council and staff listen to comments and will not engage in discussion. Council members or the City Manager may ask questions of you in order to gain a thorough understanding of your concern, suggestion or request. Please be aware that disrespectful comments or comments of a personal nature, directed at an individual either by name or inference, will not be allowed. Personnel concerns should be directed to the City Manager. Members of the City Council and some staff members may gather at Houlihan's, 530 Pond Promenade in Chanhassen immediately AGENDACHANHASSEN CITY COUNCILTUESDAY, NOVEMBER 12, 2019CHANHASSEN CITY HALL, 7700 MARKET BOULEVARDA.5:00 P.M. WORK SESSIONNote: Work sessions are open to the public.If the City Council does not complete the worksession items in the time allotted, the remaining items will be considered after the regularagenda.1.Distribute City Manager's Work Plan and Discuss Schedule for Performance Evaluation2.Discuss Metropolitan Council Bid for City Portion Cost of Sewer Lining (Project #1902)3.Discussion of 2020 Budget4.Key Financial Strategy: Discussion of Utility Fund FeesB.7:00 P.M. CALL TO ORDER (Pledge of Allegiance)C.PUBLIC ANNOUNCEMENTSD.CONSENT AGENDAAll items listed under the Consent Agenda are considered to be routine by the city council andwill be considered as one motion. There will be no separate discussion of these items. Ifdiscussion is desired, that item will be removed from the Consent Agenda and consideredseparately. City council action is based on the staff recommendation for each item. Refer to thecouncil packet for each staff report.1.Approve City Council Minutes dated October 28, 20192.Receive Planning Commission Minutes dated October 15, 20193.Resolution 2019XX: Authorize Condemnation Offers for CSAH 101 RightofWayAcquisition4.Resolution 2019XX: Approve Transfer of Remaining 2018 General Fund Surplus5.Resolution 2019XX: Approval of Plans & Specifications and Authorize Advertisementfor Bids for the Powers Boulevard/Lake Lucy Road Pedestrian Project; ApproveAmendment to Consulting Engineering Contract6.Approve Pioneer Pass Park Recreational Skating Rink7.Resolution 2019XX: Accept Bids Procured through Construction CooperationAgreement with the Metropolitan Council Environmental Services and AwardContract for Construction of Cured InPlace Pipe Project #1902E.VISITOR PRESENTATIONSVisitor Presentations requesting a response or action from the City Council must complete andsubmit the Citizen Action Request Form (see VISITOR GUIDELINES at the end of this agenda)F.OLD BUSINESSG.PUBLIC HEARINGSH.NEW BUSINESSI.COUNCIL PRESENTATIONSJ.ADMINISTRATIVE PRESENTATIONSK.CORRESPONDENCE DISCUSSION1.Review of Claims Paid 111220192.Building Permit Data as of 110120193.2019 Building Permit Activity through 1112019L.ADJOURNMENTM.GUIDELINES GUIDELINES FOR VISITOR PRESENTATIONSWelcome to the Chanhassen City Council Meeting. In the interest of open communications, the Chanhassen CityCouncil wishes to provide an opportunity for the public to address the City Council. That opportunity is providedat every regular City Council meeting during Visitor Presentations.Anyone seeking a response or action from the City Council following their presentation is required tocomplete and submit a Citizen Action Request Form. An online form is available athttps://www.ci.chanhassen.mn.us/action or paper forms are available in the city council chambers prior tothe meeting.Anyone indicating a desire to speak during Visitor Presentations will be acknowledged by the Mayor. Whencalled upon to speak, state your name, address, and topic. All remarks shall be addressed to the CityCouncil as a whole, not to any specific member(s) or to any person who is not a member of the CityCouncil.If there are a number of individuals present to speak on the same topic, please designate a spokespersonthat can summarize the issue. Limit your comments to five minutes. Additional time may be granted at the discretion of the Mayor. If youhave written comments, provide a copy to the Council.During Visitor Presentations, the Council and staff listen to comments and will not engage in discussion.Council members or the City Manager may ask questions of you in order to gain a thorough understandingof your concern, suggestion or request.Please be aware that disrespectful comments or comments of a personal nature, directed at an individualeither by name or inference, will not be allowed. Personnel concerns should be directed to the City Manager. Members of the City Council and some staff members may gather at Houlihan's, 530 Pond Promenade in Chanhassen immediately after the meeting for a purely social event. All members of the public are welcome. CITY COUNCIL STAFF REPORT Tuesday, November 12, 2019 Subject Distribute City Manager's Work Plan and Discuss Schedule for Performance Evaluation Section 5:00 P.M. WORK SESSION Item No: A.1. Prepared By Todd Gerhardt, City Manager File No: SUMMARY 2019 was another busy year for the City of Chanhassen. I am very proud of the efforts of the City Council and staff in accomplishing our annual goals and key financial strategies. Some of our accomplishments include: Approved Franchise Agreement ordinances and Franchise Fee ordinances for the main funding for our future Pavement Management Program. The city ended 2018 with a $750,000 surplus, and we are projecting another surplus of $300,000 for 2019. Expanded our Fire Department service model in creating a duty crew model. 2020 is going to be another very busy year. Some of our proposed strategies for next year include developing a strategic plan for our Pavement Management Program, continuing our Sanitary Sewer Inflow and Infiltration program, and starting the construction of Highway 101 going up the bluff. Again, I am very proud of this year’s accomplishments and look forward to establishing goals for 2020. Please call me if you have questions in regards to the 2019 Work Plan. ATTACHMENTS: City Manager's Work Plan Performance Review Schedule Job Description Performance Evaluation Form 2019City Manager’s Work Plan TODD GERHARDT, CITY MANAGER Providing Financial Stability & Resources Enhancing Goals to Access the Impact Environment for Innovation & Change Creating Solutions for Infrastructure ESTABLISH ANNUAL GOALS & KEY FINANCIAL STRATEGIES BACKGROUND: In July 2002, staff met with Jim Prosser from Ehlers & Associates to begin development of the city’s key financial strategies. At that time, comparisons were completed of similar cities based on tax base mix, growth, allocation, population, five-year budget comparison, debt ratios, tax capacity, and bond ratings. Council and staff identified Financial Foundation Descriptions and prioritized capital improvements. City Council adopted the Key Financial Strategies (KFS) on June 9, 2003. Implementation began with the 2004 budget process, i.e. pavement management system including trails, roads, parking lots; debt service; fixed assets for remodeling/replacement; water treatment and future infrastructure; etc. These strategies will also be used as a part of our 2019 strategic planning process. 2 Competitiveness Create an environment for innovation and change — building on our strengths, creativity, and skills. INCREASE STAFF FIRE DEPARTMENT HOURS (DUTY CREW PROGRAM) The Chanhassen Fire Department has experienced a steady increase in call volume over the past several years, creating an increased demand on the 45 paid on-call firefighters. Currently, duty crews are utilized primarily between 6pm and 10pm, and the program has been received very well by the department. Firefighters are essentially able to schedule themselves for duty crews, and then spend evenings off not worrying about responding to fire calls when not scheduled. Staff would like to consider expansion of this program to include overnight hours, as that is one of the highest risk times and often some of the lowest response and longest response times. Scheduling shifts would also improve retention by decreasing “all calls” during overnight hours, and ensure that there is always a set crew available to respond overnight when the community is more likely to be home. February 25, 2019: Chief Don Johnson presented at the City Council work session. Council were in agreement to expand recommended duty crew shifts for 2019. Chief Johnson outlined in a PowerPoint presentation the calls for service from 2002 to 2014 regarding two shifts per week; Friday and Saturday evenings from 6:00 p.m. to midnight. The intent was to cover those times during evenings when a large percentage of staff was unavailable. However, we did not see a high percentage of calls on these evenings. The entire fire department was still paged out for calls despite a duty crew in station so the only increase was staffing costs. The duty crew model was then changed to Wednesday through Friday evenings from 6:00 pm – 10:00 pm giving the duty crew primary call responsibility during this time. Duty crew calls do not go against the rest of the department’s call requirement and reduces unscheduled all calls during periods of high demand family time. A Tuesday evening shift was added to the schedule as the budget allowed for a cost-neutral expansion in 2018. A Monday evening duty crew was added in 2019 when station training is not scheduled as it proved to be budget neutral. Council supported also adding 2,496 weekend hours in 2019 which 3 continued to provide scheduled, timely response and provide additional relief to all calls for most of the department. It should be noted that the firefighters also requested weekend hours to expand availability of working shifts and reduce all calls during high demand family time. For 2020, the chief is proposing to add a three-person duty crew seven nights per week from 10:00 pm – 6:00 am, for a total of 8,736 additional duty crew hours. The 2020 budget impact of $120,260 (with a payroll tax of $152,700) encompasses continuing the weekend shifts added in 2019 plus the additional duty crew hours for the planned overnight coverage. The primary purpose of the overnight expansion is a significant service level increase to the citizens of Chanhassen. The community could be guaranteed a timely response during times when a majority of the community is at home. This is most important when responding to fires or significant medical events. The duty crew shift also provides the opportunity to respond to ALL medical calls received allowing deputies the option to respond or not. The overnight scheduled shifts will also benefit firefighter retention as only the crew scheduled will be awakened for most low level calls many nights of the year. As we have expanded our scheduled coverage, the overnight all calls have become more burdensome. The expansion should also improve recruitment as standards can be relaxed in regards to geography based on the guarantee that the first due engine will be responding directly from the station. The new generation firefighter has also shown a favor to scheduled crews versus paid on-call response. Finally, the expansion of scheduled shifts will allow a significant buffer for the double digit increases in calls for service the fire department is receiving. This should provide a more stable budgeting environment absorbing many of the spikes month to month and year to year. The City Council endorsed the proposed duty crew model and included it in the 2020 budget. A final decision will be made during the 2020 budget process. 4 CONSIDER IMPLEMENTATION OF A LODGING TAX With this tax, the Minneapolis Chamber of Commerce could help better market Chanhassen and local attractions as a destination for both metro residents and visitors in town for large-scale events (Final Four, Super Bowl, etc.). The Buy Chanhassen group inquired if there was any interest on the City Council’s behalf to create a lodging tax to help market the Chanhassen Dinner Theater, Paisley Park Tours and the MN Landscape Arboretum. The Buy Chanhassen group would market the city in cooperation with the “Meet Minneapolis” association. The marketing would consist of using digital marketing and other resources to help promote hotels, motels, restaurants and entertainment attractions. The Mayor and City Council asked for feedback from the local hotels regarding implementing a lodging tax and what the process would be to set that up. Some had reservation in implementing another tax and wanted a better understanding of the “Meet Minneapolis” business structure. The Buy Chanhassen group is still meeting with the hotel group and compiling the results of their feedback. I would expect they will prepare a report for the City Council to review in early 2020. IMPLEMENT A MENTAL HEALTH AWARENESS PROGRAM Work with outside organizations including, but not limited to: CCSO, Mental Health Crisis Team, Make it OK, SAVE, local schools, etc. to create and implement an outreach and education program. Tasks could include a review of service levels and expectations from CCSO, arrange and host annual or biannual mental health workshops, bring awareness to city/county/state organizational resources, and reduce stigma surrounding mental health. On February 25, 2019, Lt. Eric Kittleson reviewed the 5-year data from 2014-2018 highlighting crime numbers, medical/mental health numbers and training requirements for mental health response. All deputies have been through 40 hours of mental health training which was completed in February 2018. Lt. Kittleson went through the last five years of medical and mental health calls for service in the City of Chanhassen (see attached table for medical and mental health). 5 The following information is also included: 1. Total activity/calls for service (2014 through 2018) 2. 2018 KFS police operating budget comparison 3. City of Chanhassen prosecution service vs. Carver County services 6 7 8 9 October 2019 • A Mental Health Resources web page was created on the city’s website (http://www.ci.chanhassen.mn.us/1573/Mental-Health-Resources) • City promoted via social media and the city’s website a Mental Health Discussion scheduled for October 9 at 5:30 pm in the Chanhassen Library. • A Mental Illness Awareness article is scheduled to be published in the winter 2019-20 edition of the Chanhassen Connection newsletter. • Supported seminar organized by Carver County Mental Health Advisory Council by Susan Bartlett Foote, author of the book “The Crusade for Forgotten Souls,” followed by a question and answer session with Dr. Keyur Desai who discussed the stigma of addiction and its effects. 10 Strengthen the City’s Financial Position Provide financial stability and resources necessary to achieve the city’s vision by exercising financial stewardship, implementing best practices, and utilizing long-term financial planning tools. PAVEMENT MANAGEMENT PROGRAM DEEP DIVE Staff and City Council will review the current pavement conditions throughout the city and the full OCI map to see specific problem areas. Staff will also review and provide an update on future planned projects and the potential schedule/sequence. Staff should also provide an opportunity to thoroughly review all potential funding sources. One of the KFS goals for 2019 was to take a more detailed look at the pavement management funding need. In 2018, staff reviewed with the City Council the need for additional funding of local roads, in particular, a funding stream need be established for the city portion (60%) of local road improvements. The discussion in 2019 was to take a closer look at the pavement management system itself, the OCI (Overall pavement Condition Index), when roads were built and how to pay for the city’s share of ongoing maintenance and replacement. At the June 10 City Council work session, staff presented information about OCI, cost per mile of street maintenance, cost per mile of street reconstruction, number of miles of street per year built since 1960 and the projected cost for maintenance and reconstruction going forward. City Council requested additional funding scenarios which were presented at the June 24 City Council work session. During that presentation, staff asked for direction on the funding level the City Council would like to proceed with going forward, if the City Council would like to issue debt for the assessed share (40%), how the City Council would like to pay for the city share going forward and how to present the information to the public. The City Council did answer some of those questions on June 24, but wanted to wait to answer the funding level question and how to fund the program until after the initial 2020 budget review. The initial 2020 budget review will take place at the July 22 City Council work session at which point in time staff will be asking for direction on the funding level question and what revenue stream (Franchise Fee or Property Tax Levy) would the City Council like to use to fund the Pavement Management 11 Program. Staff will also be recommending a public input meeting to be held at the August 26 City Council regular meeting. The City Council held a public comment session on August 26, 2019. Following this meeting the council decided to move forward with the public hearing process. All comments from the August 26 meeting were included in the public hearing staff report. On October 28, 2019 the city council held a public hearing considering the adoption of a Franchise Fee to fund our Pavement Management Program. The public gave some final thoughts and comments regarding the fee during the public hearing. After the public hearing the city council gave its final comments and voted for the adoption of a residential and commercial franchise fee that would collect $1.7 million for the city’s pavement management fund. The discussion generally reflected that over three years the city council researched all ways to fund the pavement management of our local streets and using a Franchise Fee to fund at least a portion of the total city cost was the most viable and preferred option. CONDUCT A THOROUGH REVIEW OF ALL UTILITY FUND FEES Compare our operating and connection utility fund fees compared to KFS Cities and neighboring communities. The City of Chanhassen works to find a balance between the competitiveness of fees and the long-term financial stability of the utility funds. One of the KFS goals set by city council for 2019 was to review the city’s utility connection fees to see how competitive we are compared to neighbors and our KFS cities and see if there is an opportunity to make adjustments to those fees to become more competitive for development purposes. Staff, along with Ehlers and Associates, presented the comparative data at the September 23 work session. In addition, staff presented some policy changes to the rate setting practices used to allocate the system infrastructure costs to both the current users and incoming users for city council for consideration. The practices used to date are in large part due to the allocation of debt related to the water treatment plants, which was based on current population and eventual final buildout population in the city’s future. This allocation was one of the items discussed as a possible policy change. The impact of that policy change would be a shifting of costs from future users to current users and would result in lower connection fees and higher usage rates. Also, staff presented a couple of other potential policy changes surrounding time 12 of collection of fees and the lowering of the fee rate charged to multi-family uses. Staff is not recommending any changes in policy but presented these options for possible consideration by the city council. There was some discussion by the city council about not making any significant policy changes but rather make exceptions to fees paid for certain user types or businesses. Staff would not recommend an exception-based policy as it will create a number of equality and fairness issues that will present a number of significant challenges to the city as it builds out the rest of its utility system. This item will be on the November 12 work session for additional discussion and on December 9 the city council will set its rates for 2020. 13 Planning for the City’s Infrastructure Create solutions for managing existing infrastructure and future growth in our community while preserving a sustainable quality of life and protecting the environment. ADDRESS TRAIL GAPS AND TRAIL CROSSING SAFETY ISSUES During the Parks System Master Planning process, 34 trail gaps and 16 trail crossing safety concerns were identified in Chanhassen. By addressing these concerns, the overall pedestrian safety and mobility throughout Chanhassen can be greatly improved. On May 13, the City Council reviewed the ongoing need of addressing trail gaps and trail crossing safety concerns. Trail gaps currently being worked on for future construction include the Great Plains Boulevard Trail (Highway 101) between Pioneer Trail and County Road 61 concurrent with road construction, the Mill Street pedestrian trail between Chanhassen and Excelsior, the Arboretum connection trail and Hazeltine Boulevard (Highway 41) pedestrian underpass, and the final section of the Chanhassen Nature Preserve trail loop. Cooperating agencies involved in creating these pedestrian connections include Hennepin and Carver Counties, the State of Minnesota, the Cities of Shorewood and Excelsior, the Minnesota Landscape Arboretum, Life Time Fitness and Quantum Controls. A Trail Crossing Safety project was completed on Century Boulevard at Corporate Place. Trail crossing safety measures currently planned include the Lake Lucy Road Pedestrian Crossing project at Powers Boulevard and possible additional improvements at Powers Boulevard and Park Road. The largest remaining trail gap in the city is along Bluff Creek Drive between Highway 212 and County Road 61, a distance of one mile. 14 REVIEW THE PRACTICE FOR ADDRESSING CITIZEN REQUESTS FOR TRAFFIC SAFETY CONCERNS Staff would like to discuss current practices and standard traffic safety measures with council, and discuss whether changes need to be made. Once completed, staff and council will have the same procedure and standard responses so that residents hear a consistent message from all city sources. Projects for 2019 • Powers Boulevard and Lake Lucy Road Pedestrian Crossing with flashing signal arms will be bid out in January 2020 with construction in the spring of 2020 • Lake Drive East and Dakota Avenue Intersection improvements with installation of a pedestrian island – fall 2019 • West 79th Street pedestrian crossing from Tequila Butcher restaurant (former Applebee’s) to new parking lot across the street – spring 2020 • Century Boulevard and Corporate Place pedestrian crossing (Life Time Fitness) • Highway 41 at Minnetonka Middle School West (MMSW) – working with MnDOT and MMSW on striping intersection and possible future traffic signals STUDY AND CONSIDER SANITARY SEWER INFLOW/INFILTRATION (I/I) INITIATIVES Staff plans to study methods for reducing I/I of groundwater and stormwater into the sanitary sewer system, educate the public and council on the importance of reducing I/I, and develop a plan to address issues and reduce I/I. 1. The City Council approved a contract with SEH on April 22, 2019 to conduct a study that focuses on the impact private property connections have on the city’s overall I/I issues and mitigation options if an issue is identified. The study involves performing sewershed data review and collecting flow data. This data will be correlated with rainfall data to determine the locations where I/I issues are more pronounced. The cost of the study is $57,640 and a final report will be presented to the city council in November. 2. The Metropolitan Council Environmental Services (MCES) and the City of Chanhassen are undertaking similar sanitary sewer projects west of Galpin 15 Boulevard and Majestic Way for both sanitary sewer infrastructure improvements and infiltration and inflow abatement. The MCES plans to rehabilitate their trunk line (interceptor 8253-328) by installing cured in-place pipe liners and fiberglass manhole inserts, and the city plans to rehabilitate a 12-inch concrete sanitary sewer that connects to the MCES trunk line by installing cured in-place pipe liners. In an effort to take advantage of economy of scale, the City partnered with MCES to combine work into one project (piggyback). The City Council approved an agreement with the MCES for this project at the May 28, 2019 city council meeting. This project is going out for bid on October 8, 2019 and construction will take place over the winter. The City’s estimated cost is $112,350. 3. Each year the city budgets $200,000 in the Capital Improvement Plan for I/I projects. This includes the annual televising contract as well as small repair projects. This year the city has contracted with Hydro-Klean to televise and clean approximately 26,500 linear feet (5 miles) of sanitary sewer. The City Council approved this contract on August 26, 2019 in an amount of $60,703.12. The televising of the sanitary sewer allows us to identify any I/I issues and incorporate them into future projects for repair. This work will be completed by December 14, 2019. 4. Every street rehabilitation and reconstruction project includes sanitary sewer infrastructure improvements along with infiltration and inflow abatement. In 2019, the Lake Drive East Rehabilitation (Project #18-02) and Orchard Lane Area Reconstruction (Project #18-01) included sanitary sewer improvement project costs of $13,573.11 and $137,804.02, respectively. The City Council will receive an update at their December 9 work session regarding the I/I report prepared by SEH which will identify I/I issues and prioritization based on what project should be done for the biggest impact of reducing out I/I issues. 16 Enhance Local Tax Base Evaluate the Comprehensive Plan with current goals and policies; assess the impact. ESTABLISH AN ECONOMIC DEVELOPMENT ADVISORY COMMISSION TO ADVISE THE CITY COUNCIL REGARDING ECONOMIC DEVELOPMENT, HOUSING, AND REDEVELOPMENT MATTERS On May 28 at a work session meeting, staff reviewed with City Council the potential of establishing an Economic Development Advisory Commission (EDC). The discussion included reviewing some potential goals and responsibilities, a timeline for establishing the Commission and potential establishing of bylaws. After that work session, staff was given direction to proceed with creation of the Commission and on June 10 an amendment to Chapter 2 of the City Code was discussed at the regular work session and was passed. Staff was given direction to proceed with establishing bylaws by the City Council, the first discussion of which will take place on July 22. Advertisement for applications to the EDC has taken place and a tentative date of August 12 has been set for Commission interviews of applicants. The Commission membership is set to be established and the first meeting is expected to take place in either late September or October. At its first meeting on October 8, The EDC became familiar with all its new members and elected a chair and vice chair for 2019-2020. In addition, staff gave the group a brief overview of conduct related to appointed boards/officials as noted by the LMC and Campbell Knutson. Staff then reviewed the City’s 2040 Comp Plan and zoning with the EDC. The November 13 meeting has on the agenda a staff review of the Downtown Vision Plan and the City’s Business Subsidy Policy. 17 THE CITY OF CHANHASSEN HAS ONGOING ECONOMIC DEVELOPMENT GOALS AND PROJECTS THROUGHOUT THE YEAR The City of Chanhassen has ongoing economic development goals and projects throughout the year. 1. Frontier Brewery Development inquiries were received on the city-owned property at 195 West 79th Street. The city created a Request for Proposal for the property and sent it to three interested parties; two breweries and a hotel. The hotel ultimately withdrew and both breweries submitted proposals which were presented to the City Council at their May 13 meeting. The City Council selected Frontier Brewery. The owner has signed a purchase agreement, paid an escrow and is developing his plan. 2. Applebee’s Redevelopment The City Council directed the owner of the Applebee’s site to develop a restaurant on the site rather than a bank or retail. In order to facilitate the redevelopment on the site, additional parking was necessary. Staff worked with the developer to provide parking on the city-owned property. The City Council approved the additional parking layout and the parking easement at their July 8 meeting. The future tenant of the site is working on their remodeling plans and the parking lot and hope to open later this fall. 3. Liv Horneland Staff has been working with Liv Horneland who is with the Gramercy Commercial Group over the past 20 years. The property located at 1891 Arboretum Boulevard is guided for industrial development. Ms. Horneland discussed with the City Council the possibility of a land use change to provide more retail at the site. At their July 8 meeting, the City Council directed staff to work with the applicant to provide a traffic analysis and work with MnDOT to determine if access on Highway 5 is feasible. Upon completion of the analysis, the findings will be presented to the City Council. 18 4. New Developments a. Holasek Business Park An office industrial subdivision on 50 acres with a 256,000 square-foot and a 141,000 square-foot office/industrial, multi-tenant buildings. The site is currently being graded and private site utilities are being installed. Construction of the buildings will begin in August with completion of both buildings by the fall of 2020. b. Life Time Fitness Parking Lot Expansion Life Time is proposing the expansion of its parking facilities to include the addition of 181 parking stalls on their property at 2970 Water Tower Place (site plan submittal was on June 19, 2019); and the proposed addition of 167 parking stalls scattered throughout their existing campus on Corporate Place. Construction would be completed this fall. c. Control Concepts Control Concepts currently leases space within the Dell Five business park located at Dell Road and Lake Drive East. The city received the site plan for a 54,276 square-foot, two-story office, warehouse and manufacturing building to allow them to expand their operations. The site plan on Lot 2, Block 1, Arboretum Business Park 7th Addition (8077 Century Boulevard) was approved on June 24, 2019. Construction is proposed to begin this summer and be completed by the spring of 2020. 19 Other Projects and Goals Accomplished Department Accomplishments in 2019 That Were Not Included in the Key Financial Strategies. FIRE DEPARTMENT Apparatus – The fire department continued working on the apparatus replacement schedule by ordering a replacement engine in 2019. After CIP approval in January, an additional Pierce Velocity Engine was planned and ordered. This process was simplified by most specifications being similar to those of Truck 1 ordered the year prior. The new engine matches the layout, mechanical configuration, and operation to the Pierce Ladder Truck. This was intentional to ensure continuity of operation and familiarity for a primary paid on call staff. The new engine will be delivered sometime in early November and should be in service by December. The apparatus replaced a 1996 fire engine that had reached serviceable life. Scheduling Software – The fire department purchased and implemented a scheduling software package to enhance the ever-changing crew scheduling. With the expansion of duty crew hours in 2019, and the proposed further expansion in 2020, the fire department needed a more robust scheduling tool. A small group of internal subject matter experts reviewed some suites available on the market and determined Aladtec was the most economical solution with the needed features. The package was purchased in April of 2019 with implementation and transition over the next three months. Aladtec offers many benefits; decreased administrative time for schedule creation, user-friendly platform, flexibility for staff scheduling changes, and enhanced accountability and reporting. This was a major improvement to the overall operation of the fire department. COMMUNITY DEVELOPMENT Environmental • The Environmental Commission chose Energy Efficiency as their 2019 focus topic and worked with staff to promote opportunities for Chanhassen residents to learn more about the topic. The commission wrote articles for each city newsletter on the topic, had a display at the July 3 Business Expo, 20 and hosted a community event at the library that was well attended by the public. • This year the city completed its three-year treatment rotation of ash trees for Emerald ash borer (EAB). To date, all public ash trees on streets and in parks that were a part of the treatment program have been protected. Many residents have also taken advantage of the discounted treatment rate provided by the contractor and have protected their trees. EAB has been confirmed near Opus/Shady Oak in Minnetonka and by Bryant Lake in Eden Prairie. No confirmations of EAB in Chanhassen have been made. • City staff worked with a Chanhassen resident this summer to monitor Monarch activity on milkweed growing along city trails. Working together, a map of important areas of milkweed was created. These areas will be protected from mowing and highlighted for trail users through the installation of seasonal pollinator habitat signs. Economic Development • With the vacation of the Applebee’s restaurant site, staff brought to the City Council opportunities presented by the Developer. The city could either amend the PUD to allow for a bank or have the developer work to find a restaurant. The council chose to have the staff work with the developer to land a restaurant. Tequila Butcher chose the site but needed to secure additional parking to ensure their success. Staff worked with the developer to create additional parking on the city-owned property on West 79th Street. The additional 22 parking spaces includes one-way in and out and an enhanced pedestrian crosswalk across West 79th Street. The plan required review by the Watershed District, Planning Commission, and City Council. FINANCE West Water Treatment Plant Sales Tax Rebate – The Finance Department has worked diligently to document and gain approval from the Minnesota Department of Revenue (DOR) for a sales tax rebate for all materials purchased related to the construction of the West Water Treatment Plant (WWTP). This has been difficult area as most local governments have been denied rebates from the DOR for these type of facilities, due to poorly worded statutes related to local government sales tax exemptions and poorly documented processes when attempting to follow 21 those statutes. The Finance Department has been working with the DOR for over six months attempting to get the rebate for the WWTP and recently received initial approval of a rebate of $170,000 for those related purchases. This significant accomplishment means the city will not have to lobby the legislature for a rebate as some other local governments have attempted to do and have been unsuccessful at for facilities of this type. City Credit Card Rebate Program Participation – The finance department recently entered into a credit card rebate program for all city credit card purchases with US Bank. The program will achieve over a 1.50% rebate on all city purchases made via city credit cards. The initial implementation will gain about $10,000 in rebate dollars to begin with and as it is expanded to include additional expenses the rebate could become close to $50,000 in future years. ADMINISTRATION Citizen Action Request Form – With City Council direction, staff created a Citizen Action Request Form (online or paper) for anyone wishing to speak during Visitor Presentations at a City Council meeting on a topic requiring action or follow up. Since February 2019, there have been a total of 25 Citizen Action Request Forms (CARF) submitted. Modus Election Software – The city is in the process of implementing web-based election software in an effort to streamline the election process. This software will manage election parameters and planning, polling places, election equipment, and election judges and their required training. Since the application is web based, data will be housed in a central location and not on our servers. Access to the data can be enabled or limited based on user needs, allowing more than one user to access and manipulate/update the data. It will also allow the judges to access and update their own information, register for training, and complete timesheets. Software implementation and training will occur in November and December with the intention of going live in the upcoming 2020 elections, beginning with the Presidential Nomination Primary election on March 3, 2020. The addition of this software will save significant staff time, especially as it relates to maintaining the election judge database and streamlining communication with election judges. Carver County purchased the software for their use and will be billing participating cities on an annual basis. Because Carver County negotiated a contract with the 22 vendor for county-wide use, the vendor is providing a discount of 2.5% for each entity that chooses to purchase the software, up to 10%. At this time, only Carver County, Chaska and Chanhassen are participating, providing for a 7.5% discount the first year. PARK AND RECREATION Chanhassen Recreation Center Silver Sneakers and Renew Active Health Programs – The Chanhassen Recreation Center has joined a national network of health clubs that provides Senior Citizens free access to utilize our fitness facility, play pickleball or basketball. Silver Sneakers pays for visits and Renew Active by United Health Care pays a flat rate of $1,000 each month. These programs are benefits that are included in various Medicare Advantage plans. We are proud to offer this service that provides our seniors a way to keep healthy, active, and social. We are projecting well over 1,000 visits in the first year of offering these programs. Chanhassen Senior Center Maple Corner Remodeling - This past year the Chanhassen Senior Center created a new space, the Maple Corner, with the goal of offering a comfortable and welcoming space for smaller groups, events, meals, and classes. In the process of pursuing plans to update furniture in the renamed Maple Corner, Love INC’s FurniShare was willing to partner with us to redesign and redecorate the entire room, not just furniture, using a repurposing model with new materials added in. Additionally, our Senior Commission helped us pursue donations from the American Legion and numerous other local businesses to cover the remodel costs. Within just a few short months, the room was transformed into a welcoming, comfortable space where our community seniors can spend time enjoying new activities and friendships for many years to come. PUBLIC WORKS/ENGINEERING • Completed the 5-year work plan assigned by MCES for the sanitary surcharge event that occurred in 2014. • Submitted a grant application to MCES for I/I (infiltration and inflow into our sanitary sewer system) through a State-funded program. MCES approved 23 our application and have indicated it is highly likely that we will receive some grant funding. Our application was for up to $274,000 but the amount awarded is still to be determined by MCES. • Completed rehabilitation of the 1.5 million gallon Water Tower #3. • Worked through the plan review process and all of the coordination required to bring the first phase of the The Park development to construction. • Development of 100% plans for the TH 101 Reconstruction project to be bid in December including acquisition of a majority of the necessary right-of- way. • Designed and completed a project to implement a safer pedestrian crossing at Century Boulevard and Corporate Place including new pedestrian ramps, a pedestrian refuge in the median, signage, and a zebra-striped crosswalk. LAW ENFORCEMENT Coffee with a Cop – The first Coffee with a Cop was held October 2 at Starbucks. Overall I believe this was a success for our first try at this community engagement event. We were there for about an hour and spoke with some people. Starbucks helped with advertising it in their store as well as posting on social media. We did have some interaction with the public including a group of children that came just to see the deputies. Comments on social media after the event are all positive. While we were there, management asked if one of the deputies would like to work the drive-thru window. Deputy Hastings worked the window for a few minutes, which was obviously noticed by the staff and customers in the drive thru. We will look to January for our next event and move the venue to a different location, as well as find some other ways to advertise and maybe bolster numbers of citizens. Increased Required Training by the MN POST Board – In 2018, the Minnesota Peace Officer Standards and Training (POST) Board implemented new training requirements for licensed peace officers. Those requirements are 16 hours of training in crisis intervention and mental illness crisis, conflict management and mediation, recognizing and valuing community diversity and cultural differences to 24 include implicit bias. These hours are in addition to the 48 hours of training required to maintain a peace officer license every three years. The Sheriff’s Office has an internal requirement that all deputies attend a 40-hour crisis Intervention training course after completion of probation. Most, if not all, deputies have met this requirement. In addition, the Sheriff’s Office has developed a training plan to meet the new training requirement of the POST Board. ESTIMATED CITY FEES ON A $600K HOUSE Developmental Phase Amount Administrative Fee $805.39 GIS $25.00 Surface Water Managment Fee ( Low Density ) $3,781.82 Park Fee ( Low Density ) $5,800.00 Sewer Hookup $691.00 Water Hookup $2,311.00 Street Lights $100.00 Estimated City Fees Per Lot $13,514.21 Comparison Values Fees Percent Lakeville $415,000 $17,015.66 4.10% Savage $404,000 $19,326.31 4.7% Chanhassen $600,000 $28,770.00 4.78% Other Fees Eroison Control Returned Upon Completion $1,500.00 Landscaping Escrow Returned Upon Completion $750.00 MCES SAC $2,845.00 State Surcharge $300.00 Permit valuation is based on average new single family home built in 2019. Development data is based upon 5 plats currently under development (128 lots). Building Phase Amount Water Hookup $5,393.00 Water Meter $415.54 Sewer Hookup $1,611.00 City Surcharge $75.00 Building Permit - Valuation $3,935.65 Plan Check Fee $2,558.17 Mechanical Fee $327.50 Heating Fee $327.50 Plumbing Fee $417.50 Electrical Permit issued by the State $195.00 Estimated City Fees Per Lot $15,255.86 Total City Costs $28,770.07 ( $7,761.32 Total Bldg. Permit ) On a $600K house, 4.78% of the price, or $28.8K in city fees, provides new home owners:CITY FEES FOR NEW HOMEOWNERSBY THE NUMBERSBuildingInspection $7,761 Average 15 - 20 inspections to ensure houses are built safely and to code. Infrastructure Water, Sewer, and Roads $805 Insures roads are built to city standards. WaterConnection $8,120 Funds water towers, treatment facilities, and wells needed for a growing city. ParkDedication $5,800 Construction of new parks and trails. Surface/Storm WaterManagement $3,782 Managing surface water runoff to protect property, wetlands, lakes, and creeks. SanitarySewerConnection $3,377 Treatment of things that are flushed through pipes to the regional treatment facilities. Traffic Control,Street Signs,& Map Fees $125 New street signs and street lights. Engi neeri n g Develop me nt Contract Ad m i n i strati on Engineering Development lnspection Environmental Resources Fee GIS Mapping Fee Park Dedication in Lieu of Land (Low Density) Platting Sa nitary Sewer Availa bilitY Storm Sewer Area Charge 732.64 377.6s 57.52 90.00 4,294.04 42.96 327.A4 2,33L.75 35.48 49.72 Street Lights Traffic Control Water Connection Water Meter and Pressure Reducing Valve Sanitary Sewer Connection Building Permit Plan Check Fee (Review Building Plans) 4,100.00 480.00 825.00 2,292.75 573.19 90.00 90.00 90.00 135.00 Plumbing Permit Water/Sewer Permit Mechanical Permit Electrical Permit Estimated s 5.94Fees Per Lot other Fees collected by city (Passed Through to outside Agencies) Metropolitan Council - SAC Unit State of Minnesota - State Surcha 2,485.00 1s3.00 Other Escrows (Returned to Suilder Upon Completion) City of Lakeville - LandscaPing 1,000.00 1,000.00Cityof Lakeville - Erosion Control #,,,ESTIMATED CITY FEES O N-g rarcediue A NEW$+tsK HousE $327L Estimated Total Costs Permit valuation is based on average new home built in 2019. Development phase data is based upon 11 plats currently under development (456 units). Phase Amount Estimated Fees Per Lot 72 Phase H eJ-Ldlffiille oN A $+t5K HOUSE, 4.1o/o OF THE PRtCE, OR $tZX. !N CITY FEES, PROVIDES NEW HOME OWNERS: .,4 Lskeyille *Complete details on reverse side BUILDING INSPECTION $3271. Average l5-2O inspections to ensure house is built safely & to code WATER CONNECTION Funds water towers, treatmen, t i,il,9": & wells needed for a growing city PARK DEDICATION $+zg+ Construction of new parks and trails t STORM WATER MANAGEMENT Keeps storm water in the right t,:::tA protects wetlands, rivers & streams NEW ROADS INSPECTED $rrro Developers build the roads, but the City inspects & monitors construction to ensure they are built correctly SANITARY SEWER CON NECTION $ezs When you flush, that stuff needs to travel through pipes to regional treatment facilities TRAFFIC CONTROL, STREET SIGNS & MAP FEES $r+o New streets need signs & street lights; data is shared with map applications so friends & family can find your home -,\-r\-r\-r\ ESTIMATED CITY FEES ON A NEW $404K HOUSE Permit valuation is based on average new home built in 2019. Development phase data is based upon 1 l plats currently under development (456 units). Tank, source, supply Environmental studies Park fee Construction observation Eng Administration Plat review Per Lot Meter and inspection Survey Fees Mechanical System Permit Fee Plan Review Plumbing System Sewer Connection Erosion Control Water Connection Btimabd Gty Fccs Fer Lot Pass Through Fees Sewer Access Charge State Surcharges Escrows $7s7.99 $164.24 $3,842.00 $1,530.47 $765.24 $289.1 3 $760.00 $92.00 $129.00 $3,238.6s $2,10s.12 $129.00 $2,302.43 $1s0.00 $3,071.04 j11,977.OO $2,48s.00 $204.00 $2,000.00 919,326.31 DEVELOPMENT PHASE AMOUNT BUILDING PHASE $404,000.00 t ah+._-.\ r -h; Cost TOTALCITY FEES VALUATION OF HOME ON A $404K HOUSE,4.7o/o OF THE PRICE, OR $19K IN CITY FEES, PROVIDES NEW HOME OWNERS: BUTLDING INSPECTIONS $6,603,77 Average 15-20 inspections to ensure house is built safely and to code, WATER CONNECTION $3,071 04 Funds water towers, treatment facilities, and wells needed for a growing city. PARK DEDICATION $3,842 Construction of new parks and trails. STORM WATER MANAGEMENT $O Keeps storm water in the right place and protects wetlands, rivers, and streams. !NFRASTRUCTURE INSPECTED $1,530 Developers build the roads, but the City inspects and monitors construction to ensure they are built correctly. SANITARY SEWER CONNECTION $2,302 43 Wtren you thrsh, tnt stuff needs to trawlthror.rgh pipes to Edond treatment facilities. TRAFFTC CONTROL, STREETS sIGNS, AND MAP FEES $76s New streets need signs and street lights; data is shared with map applications so friends and family can find your home. o o o 4 City of Chanhassen 7700 Market Bouleva Chanhassen, MN 55 952-227-1100 2019 Building Permit Activity Thru Nov. lr20l9 5 35lll54Residential Single-FamilY 1806t20Residential Townhomes 0000UApartrnents/Senior Facilities 5352274Total Residential 0 3J00New 1I000Redeveloped 50320t4l3Remodeled 54423t4l3Total Commercial 125758l99Single-Family Lots 2443496lResidential Townhome Lots 149118130160Total Available Lots 49554810057Single-Family 56t20496Townhomes 26807600Apartments/Senior Facilities 586710910982Commercial 431t34213233235Total Number of All Permits \\cfs5\cfs5\shared data\admin\forms\buildingpennitactivity20l9Y'tddoc Residential Building Permits I't Quarter 2nd Quarter 3'd Quarter YTD 4th Quarter Total YTD Commercial Building Permits l't Quarter 2nd Quarter 3'd Quarter YTD 4th Quarter Total YTD Available Lot InventorY (end of Ouarter) l't Quarter 2nd Quarter 3"d Quarter YTD 4th Quarter Total Permit HistorY 2014 2015 2016 2017 2018 11t6t20192019 BUILDING PERMIT DATA SF N!. t0t t02 103 104 t05| l0elI ____l 2t3' 214 -318fxe M0 I r2llt| 323l\u I r25 I i25 I tzt ft28 2 I I I 1 6 1 APRIL 3 3 3 6 l2 0 0 t2 55 $ $ $ $ 'ALS 50R 649 1 48 48 2 I 2 2 l 38 ls 2 4l 39 I 75 78 75 t2 ,750 t02 108 I .l 98 t05 390 I I 3l \\cb5\c65\Shared-Oatr\PLAN\CENSUS\RPT 201 9 OTHER Subtota @- Amumat Churchc Indushial lpa*ing lswie statiorvnryir lHmireylNitution.l 1offi."/B.r"r"r"f*t"*t I public worrs I Schools I stoc lrxto lshftc oth6 rhar blde. I s"btou UlitE - =L ILLl-- I Ifl_t- Et- I IL- Itrl--r It-I EUE 6 t -___1 ___:- =L I I =I I I t--t-f- Sublota Btdse l9 o 0 0 2t 0 c c 11t6120192019BUILDING PERl,llIT DATA IoTHER II s,+rorati I lseton 3 Nor6idatialIA'm-- -_-..J I c.hurche Itnausdal IPflinc lsqui $,t"rR"*t'- lHmihYlnstitutional I of f ccEgmnrProfeional I Public works ls.ftmls lSbr6 lotts OR MORE r0t 3 -323 JL]LY I 5 5 -15 0 33 5l SO $0 Avtrage 6 7 7 87 I I -l 6 6 I I $s00 7 I I I ;t4 .l I I I 700 #DM0l $0 $0 5 5 g I { \\c'fss\c*5\Shared-Data\PLAN\CENSUS\RPT 201 I -. = ILF =-t-- - =l) e 3 t- I =I Fl-- =ll ,L- IL Il--L-lr BUILDING PERMIT COMPARISON 2016 - 2019 11/6/2019 Permits Bldgs.Units Valuation Permits Bldgs.Units Valuation Permits Bldgs.Units Valuation Permits Bldgs.Units Valuation Section 1 Residential SF DETACHED 46 46 46 18,834,000$ 55 55 55 22,798,000$ 49 49 49 19,865,000$ 35 35 35 21,675,591$ SF ATTACHED 2 2 2 441,000$ 12 3 12 2,472,000$ 25 11 54 11,431,000$ 13 3 18 3,552,000$ 2-FAMILY 0 0 0 -$ 0 0 0 -$ 1 1 2 540,000$ 0 0 0 -$ 3-4 FAMILY 0 0 0 -$ 0 0 0 -$ 0 0 0 -$ 0 0 0 -$ 5 OR MORE FAMILY 1 1 76 10,500,000$ 0 0 0 -$ 2 2 268 41,000,000$ 0 0 0 -$ Subtotal 49 49 124 29,775,000$ 67 58 67 25,270,000$ 77 63 373 72,836,000$ 48 38 53 25,227,591$ 0 Section 2 Residential, Non 0 HOTELS/MOTELS 0 0 0 -$ 0 0 0 -$ 0 0 0 -$ 0 0 0 -$ OTHER 0 0 0 -$ 0 0 0 -$ 0 0 0 -$ 0 0 0 -$ Subtotal 0 0 0 -$ 0 0 0 -$ 0 0 0 -$ 0 0 0 -$ Section 3 Nonresidential Amusement 0 0 0 -$ 0 0 0 -$ 0 0 0 -$ 1 1 0 3,850,000$ Churches 0 0 0 -$ 0 0 0 -$ 0 0 0 -$ 0 0 0 -$ Industrial 0 0 0 -$ 0 0 0 -$ 0 0 0 -$ 1 1 0 5,400,000$ Parking 0 0 0 -$ 0 0 0 -$ 0 0 0 -$ 0 0 0 -$ Service Station/Repair 2 2 0 3,800,000$ 0 0 0 -$ 0 0 0 -$ 0 0 0 -$ Hospital/Institutional 0 0 0 -$ 0 0 0 -$ 0 0 0 -$ 0 0 0 -$ Offices/Banks/Professional 0 0 0 -$ 1 1 0 1,302,000$ 1 1 0 17,000,000$ 2 2 0 18,000,000$ Public Works 0 0 0 -$ 2 2 0 5,651,000$ 0 0 0 -$ 0 0 0 -$ Schools 0 0 0 -$ 0 0 0 -$ 0 0 0 -$ 0 0 0 -$ Stores 0 0 0 -$ 0 0 0 -$ 2 2 0 3,000,000$ 0 0 0 -$ Other 8 8 0 1,903,000$ 11 11 0 129,000$ 5 5 0 49,000$ 3 3 0 95,000$ Structures other than bldg.89 0 0 757,600$ 69 0 0 282,000$ 64 0 0 289,500$ 65 0 0 404,500$ Subtotal 99 10 0 6,460,600$ 83 14 0 7,364,000$ 72 8 0 20,338,500$ 72 7 0 27,749,500$ 0 Section 4 Additions 0 Residential 594 594 0 12,432,065$ 800 800 0 16,226,300$ 768 768 0 13,258,993$ 743 743 0 13,718,000$ Nonresidential 65 65 0 9,506,150$ 72 72 0 15,471,800$ 58 58 0 9,442,000$ 50 50 0 11,776,900$ Garages 7 7 0 405,000$ 4 4 0 111,000$ 6 6 0 126,052$ 5 6 1 400,500$ subtotal 666 666 0 22,343,215$ 876 876 0 31,809,100$ 832 832 0 22,827,045$ 798 799 1 25,895,400$ 0 0 0 -$ Section 5 Demolition 0 0 0 -$ SF Attached 76 79 7 1,634,803$ 9 9 9 -$ 3 3 3 -$ 4 4 4 -$ 2 Family 12 12 0 2,565,800$ 0 0 0 -$ 0 0 0 -$ 0 0 0 -$ 3-4 family 1 1 0 185,000$ 0 0 0 -$ 0 0 0 -$ 0 0 0 -$ 5 or more family 0 0 0 -$ 0 0 0 -$ 0 0 0 -$ 0 0 0 -$ Other 1 1 1 -$ 2 2 1 -$ 2 2 0 -$ 5 5 0 -$ Subtotal 90 93 8 4,385,603$ 11 11 10 -$ 5 5 3 -$ 9 9 4 -$ TOTALS 904 818 132 62,964,418$ 1037 959 77 64,443,100$ 986 908 376 116,001,545$ 927 853 58 78,872,491$ Average Valuations Section 1 Residential 0 0 OVERALL AVERAGE -$ 0 0 OVERALL AVERAGE -$ 0 0 OVERALL AVERAGE -$ 0 0 OVERALL AVERAGE -$ SF DETACHED 0 0 0 401,638$ 0 0 0 420,195$ 0 0 0 406,275$ 0 0 0 619,303$ SF ATTACHED 0 0 0 220,500$ 0 0 0 206,000$ 0 0 0 212,403$ 0 0 0 197,333$ 2-FAMILY 0 0 0 #DIV/0!0 0 0 #DIV/0!0 0 0 270,000$ 0 0 0 #DIV/0! 3-4 FAMILY 0 0 0 #DIV/0!0 0 0 #DIV/0!0 0 0 #DIV/0!0 0 0 #DIV/0! 5 OR MORE FAMILY 0 0 0 138,158$ 0 0 0 #DIV/0!0 0 0 152,985$ 0 0 0 #DIV/0! Average 0 0 0 262,952$ 0 0 0 392,851$ 0 0 0 185,370$ 0 0 0 475,992$ 20172016 2018 2019 \\cfs5\cfs5\Shared_Data\PLAN\CENSUS\RPT Comparison 2016 - 2019 c:\program files (x86)\neevia.com\docconverterpro\temp\nvdc\aed5f8c1-b2f6-4e20-9a35- 8e4caa9e3e88\chanhassen.3959.1.schedule_for_2019_city_manager_review.docx SCHEDULE FOR 2019 CITY MANAGER’S PERFORMANCE REVIEW November 12: City Manager distributes 2019 Work Plan along with performance review sheets. Mayor Ryan will tabulate the results after she receives everyone’s evaluation sheet by November 18, 2019. November 18, 12 noon City Council submits their individual performance review sheets for tabulation to Mayor Ryan and then the city council creates one overall performance evaluation. November 25: Executive Session of the City Council to discuss the City Manager’s overall performance and finalization of evaluation and compensation document. December 2: Executive Session of the City Council and City Manager to discuss overall performance and finalization of the performance evaluation/ compensation document (before the Truth-in-Taxation hearing); and Announce Results of City Manager’s Performance Evaluation. JOB DESCRIPTION CITY OF CHANHASSEN POSITION: City Manager CLASSIFICATION: Exempt DEPARTMENT: Administration DATE: January 2015 ______________________ OBJECTIVE AND SCOPE Plans and directs all City operations to ensure efficient municipal services and development are in accordance with objectives and general guidelines established by the City Council. To advise the Council regarding impact of policy decisions and to represent the interests of the City of Chanhassen in metropolitan and state activities as delegated by the City Council. RELATIONSHIPS Reports to: City Council Supervises: Department Heads and Support Staff Has indirect supervision over all employees of City government through the supervisory department heads identified above. SPECIFIC RESPONSIBILITIES 1. Plans and directs the general administration of city services. 2. Involve the City Council in determining annual strategies/goals. Ensure that each strategy/goal is presented to the City Council for review and direction. 3. Provides advice and/or recommendations, with supportive data, to the City Council as a guide to its policy-making role. 4. Relieves the Council members of as much administrative detail, inquiry, etc. as possible so they may devote more of their time to the policy-making responsibilities of their position. a. Prepares agendas for Council meetings and provides supporting data. 5. Keeps the City Council informed on all important developments which may affect the administration of City government and which they will need to know to perform effectively as Council persons. 6. Coordinates administration and services being rendered by the various departments of City government to ensure that the best service level is being achieved; including: a. Recommending staffing levels as well as other changes in administration as may be justified to assure a high standard of performance is maintained. b. Appoints, dismisses or otherwise disciplines city employees. 7. Involves department heads in the identification of achievement goals that will provide standards against which to measure their performance. a. Reviews periodically and confers with department managers to assure that progress in each area is being achieved as planned. b. Oversees implementation of financial and fiscal planning in the City. 8. Follows through to assure that all City Council ordinances and directives are correctly interpreted and implementation as planned. 9. Keeps informed on all aspects of municipal government and researches improved methods of administration for possible implementation in Chanhassen. REQUIREMENTS Education/Experience: Master's Degree in Public Administration, Urban Studies or related field with a minimum of 10 years of city government administrative experience, including six years of supervisory experience. City of Chanhassen Performance Appraisal Form Ratings Exceptional – This employee consistently achieves the highest level of performance in his/her duties, and often goes above the call of duty. As such, consideration should be given to rewarding this employee with a high salary increase. Excellent – This employee is a high-quality asset to the organization and is more often than not considered to be a high achiever. While not reaching the level of an exceptional employee, consideration should be given to rewarding this employee with a moderate to high salary increase. Satisfactory – This employee can be counted on to perform his or her duties in a reliable fashion. Employees in this range generally accomplish tasks on time and in a satisfactory manner and are assets to the organization. Efforts could be made to be considered a high achiever, but a moderate salary increase could be considered. Unsatisfactory – Employees in this range are not meeting the expectations of the job, and need considerable improvement. They are often considered unreliable, and more often than not fail to accomplish job duties in an acceptable manner. Steps should be discussed to improve his or her performance, and salary increases should not be considered. Todd Gerhardt 2019 Performance Evaluation 2019 Performance Evaluation - Todd Gerhardt 2 Category Rating Quality of Work (consider accuracy, completeness, and thoroughness in completing job assignments and deadlines, also ensures that the work of others is of the same quality ) Comments: 0 Unsatisfactory 1 Satisfactory 2 Excellent 3 Exceptional Category Rating: ___ Leadership (Inspires staff to high levels of performance and teamwork, holds staff accountable for their duties) Comments: 0 Unsatisfactory 1 Satisfactory 2 Excellent 3 Exceptional Category Rating: ___ Job Knowledge (Knows the intricacies of the cities processes and is current with trends and practices that may be evolving outside of the city) Comments: 0 Unsatisfactory 1 Satisfactory 2 Excellent 3 Exceptional Category Rating: ___ Strategic Initiative (possesses resourcefulness, self-starting work habits, adaptability to change, ability to work outside the box, motivates staff to think long term ) Comments: 0 Unsatisfactory 1 Satisfactory 2 Excellent 3 Exceptional Category Rating: ___ 2019 Performance Evaluation - Todd Gerhardt 3 Integrity and Trust ( can be widely trusted, is seen as a direct and truthful staff member, keeps confidences, admits mistakes, and doesn’t misrepresent himself for personal gain Comments: 0 Unsatisfactory 1 Satisfactory 2 Excellent 3 Exceptional Category Rating: ___ Cooperation and Communication (has a positive attitude, and exhibits cooperation, and effectiveness in working with others; has an strong ability to inform, staff, council, and the public with all information needed) Comments: 0 Unsatisfactory 1 Satisfactory 2 Excellent 3 Exceptional Category Rating: ___ Customer Service (exhibits courtesy, and professionalism in dealing with all customers, including the public as well as council and any other outside agencies) Comments: 0 Unsatisfactory 1 Satisfactory 2 Excellent 3 Exceptional Category Rating: ___ 2019 Performance Evaluation - Todd Gerhardt 4 Overall Ranking Exceptional (3) Excellent (2) Satisfactory (1) Unsatisfactory (0) Additional comments by person performing the evaluation: Evaluator Name_______________________________ CITY COUNCIL STAFF REPORT Tuesday, November 12, 2019 Subject Discuss Metropolitan Council Bid for City Portion Cost of Sewer Lining (Project #1902) Section 5:00 P.M. WORK SESSION Item No: A.2. Prepared By Bruce Loney, Interim Public Works Director/City Engineer File No: Project No. 201902 SUMMARY This item will be presented by staff from the attached presentation. This is an evaluation of the discrepancy between the design engineer's estimate and the received bids. ATTACHMENTS: Presentation Engineer's Estimate vs. Bids Project Overview •Approximately 1100 feet of CIPP lining of 12” reinforced concrete pipe •Raise 3 manholes (MH 21-077, 21-080, and 16-063) above wetland OHW •Temporary conveyance of sanitary waste to complete CIPP lining •Wetland restoration and erosion control Project Importance Submerged MH 16-063 in wetland. Photo taken mid-April 2019 during wetland delineation, provided by HR Green. Image inside the 12” RCP sanitary main Joint connecting 12” RCP pipe With a majority of the 12” RCP beneath wetlands (1100 feet), approximately 110 joints where infiltration can occur. Cost Analysis Design engineer’s estimate The four contractors’ bids Average cost of four bids Awarded bid vs. design estimate Awarded bid vs. average bid •Design engineer’s estimate was provided at 30% design to execute Cooperative Agreement between MCES and City •Estimate did not account for scope of work in wetland due to required manhole rehabilitation (inundated manholes discovered after design) •Estimate utilized “bio-rolls” for erosion control, while RPBCWD will require j-barrier silt fence (bids reflect j-barrier) •Low bid approximately $15,000 less than average bid (-6.0%) CITY COUNCIL STAFF REPORT Tuesday, November 12, 2019 Subject Discussion of 2020 Budget Section 5:00 P.M. WORK SESSION Item No: A.3. Prepared By Greg Sticha, Finance Director File No: BACKGROUND At the September 23rd city council meeting the city council set the preliminary levy at $11,741,368 or $510,000 above new growth. This evening staff will be looking for direction on which items to include as part of the amount above new growth for setting the final levy on December 9th. Mayor Ryan has requested the projected increases in all of our rate setting projections to be included as part of the discussion. Below is listed each of the projected increased costs based on a $430,000 four person home with gas and electric utilities in Chanhassen for 2019: Franchise Fee: $120/year Utility Rate Increase (5%): $48/year Levy Increase based on Preliminary Levy: $50/year The following are the items that are under consideration for the additional levy dollars and the justifications for each: Fund Additional Street Maintenance Employee ($80,000): The Street Maintenance Division is currently comprised of eight fulltime employees: Six Equipment Operators, a Street Foreman and a Superintendent. Fulltime staffing levels in this division have not increased in 22 years. However, the city’s street and storm water system and associated maintenance responsibilities have increased substantially over that same time period. The population of the city has increased by 10,000 residents and along with it a significant number of miles of streets and storm sewer has been added to the city’s network. As the city’s street and storm sewer infrastructure continues to age and deteriorate, it has become all but impossible to adequately meet citizen expectations with current staffing levels. The addition of another FTE would increase the Street Maintenance Division’s ability to complete the following required tasks in a more timely and efficient manner: pothole repair, drainage repairs, crack sealing, street sweeping, street light maintenance, culvert replacement, sign repairs/replacement, street plowing/snow removal, pavement marking/crosswalk striping, and mowing. In addition, the Street department is planning for the following pothole and patching plan for 2020: 2020 Pothole Patching Plan In 2019, the city of Chanhassen experienced a large number of potholes in their street pavement system. Public Works staff is still patching streets as of October 30, 2019. In order to improve the level of service in restoring pavements, staff is proposing to do the following: CITY COUNCIL STAFF REPORTTuesday, November 12, 2019SubjectDiscussion of 2020 BudgetSection5:00 P.M. WORK SESSION Item No: A.3.Prepared By Greg Sticha, Finance Director File No: BACKGROUNDAt the September 23rd city council meeting the city council set the preliminary levy at $11,741,368 or $510,000above new growth. This evening staff will be looking for direction on which items to include as part of the amountabove new growth for setting the final levy on December 9th.Mayor Ryan has requested the projected increases in all of our rate setting projections to be included as part of thediscussion. Below is listed each of the projected increased costs based on a $430,000 four person home with gasand electric utilities in Chanhassen for 2019: Franchise Fee: $120/yearUtility Rate Increase (5%): $48/year Levy Increase based on Preliminary Levy: $50/yearThe following are the items that are under consideration for the additional levy dollars and the justifications for each:Fund Additional Street Maintenance Employee ($80,000):The Street Maintenance Division is currently comprised of eight fulltime employees: Six Equipment Operators, aStreet Foreman and a Superintendent. Fulltime staffing levels in this division have not increased in 22 years. However,the city’s street and storm water system and associated maintenance responsibilities have increased substantially overthat same time period. The population of the city has increased by 10,000 residents and along with it a significantnumber of miles of streets and storm sewer has been added to the city’s network. As the city’s street and storm sewerinfrastructure continues to age and deteriorate, it has become all but impossible to adequately meet citizen expectationswith current staffing levels. The addition of another FTE would increase the Street Maintenance Division’s ability tocomplete the following required tasks in a more timely and efficient manner: pothole repair, drainage repairs, cracksealing, street sweeping, street light maintenance, culvert replacement, sign repairs/replacement, street plowing/snowremoval, pavement marking/crosswalk striping, and mowing. In addition, the Street department is planning for thefollowing pothole and patching plan for 2020:2020 Pothole Patching PlanIn 2019, the city of Chanhassen experienced a large number of potholes in their street pavement system. PublicWorks staff is still patching streets as of October 30, 2019. In order to improve the level of service in restoring pavements, staff is proposing to do the following: For 2020, street staff will have a second sweeper for the first time and the goal will be to cut the sweeping time in the spring in half, so as to allow street department staff to get to pothole patching earlier than normal. Estimating a earlier time of three weeks. Also in the 2020 budget is proposed to add a street maintenance employee which will increase the number of hours available for patching. Within the street preservation budget for 2020 of $400,000, staff is proposing the following expenditures within this budget account: $65,000 Contractor patching $65,000 Materials for asphalt and concrete repairs by PW staff $20,000 Restriping of streets $225,000 to $250,000 Seal coating and crack sealing of pavements With the increase in the 2020 budget for street preservation, the city can contract with an asphalt contractor to do about 2 to 3 weeks of patching. Attached is a drawing showing the areas that a contractor would do in the early spring. Staff would do the patching for the rest of the community. Staff believes with the added sweeper, added person in the street maintenance area, and assistance with an asphalt contractor in spring, the patching of pavements could be done by August 15, 2020 and earlier depending on the severity of the winter. Another benefit of getting the patching of streets done earlier is to free up street department staff to get to other tasks that are backlogged due to the amount of street patching. Listed below are some of the tasks that need attention: Maintenance tasks backlog Maintain and clean deltas around inlets and outlets of ponds and wetland areas Repairing storm pipes, manholes, catch basins Repairing low manhole covers in the streets Replace and repair broken sidewalks Trail patching Removing diseased and dangerous trees as well as maintaining tree trimming for sight line issues Currently the city only cleans 12 ponds per year which we currently have 260 ponds in the city Currently the street/surface water division only can inspect and maintain a quarter of the city’s 157 sump manholes per year, which is the minimum requirement for the NPDES Phase 2 permit The city is not currently in compliance with the retroreflective street sign inspections Removal of volunteer tree growth around storm water ponds Fund additional park maintenance employee ($80,000): The Park Maintenance Division is currently comprised of seven fulltime employees (FTE): Five Light Equipment Operators, a Park Foreman and a Superintendent. Fulltime staffing levels in this division have not increased in 21 years. But the city’s park and trail system and associated maintenance responsibilities have approximately doubled in size over that same time period. The last time fulltime positions were added was in 1998 with two park maintenance positions. As the city’s park system infrastructure continues to age and deteriorate, it has become all but impossible to adequately meet citizen expectations with current staffing levels. The addition of another FTE would increase the Park Maintenance Division’s ability to complete the following required tasks in a more timely and efficient manner: mowing and maintaining all city parks, street boulevards and the downtown; park shelter maintenance; ball field grooming; fence repair; field striping; snow removal; ice hockey and ice rink maintenance; tree pruning; fertilizing; herbicide applications; irrigation repair; and special event preparation and execution. Fund half time fire department admin position at full time ($37,000): This position has been a contracted employee for the past four years. The Shared Service Agreement (SSA) was created to incentivize a longterm, parttime Excelsior employee to stay working in a unique field. Within the agreement, the position made a full time Excelsior Fire District (EFD) employee with Chanhassen paying half off the CITY COUNCIL STAFF REPORTTuesday, November 12, 2019SubjectDiscussion of 2020 BudgetSection5:00 P.M. WORK SESSION Item No: A.3.Prepared By Greg Sticha, Finance Director File No: BACKGROUNDAt the September 23rd city council meeting the city council set the preliminary levy at $11,741,368 or $510,000above new growth. This evening staff will be looking for direction on which items to include as part of the amountabove new growth for setting the final levy on December 9th.Mayor Ryan has requested the projected increases in all of our rate setting projections to be included as part of thediscussion. Below is listed each of the projected increased costs based on a $430,000 four person home with gasand electric utilities in Chanhassen for 2019: Franchise Fee: $120/yearUtility Rate Increase (5%): $48/year Levy Increase based on Preliminary Levy: $50/yearThe following are the items that are under consideration for the additional levy dollars and the justifications for each:Fund Additional Street Maintenance Employee ($80,000):The Street Maintenance Division is currently comprised of eight fulltime employees: Six Equipment Operators, aStreet Foreman and a Superintendent. Fulltime staffing levels in this division have not increased in 22 years. However,the city’s street and storm water system and associated maintenance responsibilities have increased substantially overthat same time period. The population of the city has increased by 10,000 residents and along with it a significantnumber of miles of streets and storm sewer has been added to the city’s network. As the city’s street and storm sewerinfrastructure continues to age and deteriorate, it has become all but impossible to adequately meet citizen expectationswith current staffing levels. The addition of another FTE would increase the Street Maintenance Division’s ability tocomplete the following required tasks in a more timely and efficient manner: pothole repair, drainage repairs, cracksealing, street sweeping, street light maintenance, culvert replacement, sign repairs/replacement, street plowing/snowremoval, pavement marking/crosswalk striping, and mowing. In addition, the Street department is planning for thefollowing pothole and patching plan for 2020:2020 Pothole Patching PlanIn 2019, the city of Chanhassen experienced a large number of potholes in their street pavement system. PublicWorks staff is still patching streets as of October 30, 2019. In order to improve the level of service in restoringpavements, staff is proposing to do the following:For 2020, street staff will have a second sweeper for the first time and the goal will be to cut the sweeping time in thespring in half, so as to allow street department staff to get to pothole patching earlier than normal. Estimating a earliertime of three weeks.Also in the 2020 budget is proposed to add a street maintenance employee which will increase the number of hoursavailable for patching.Within the street preservation budget for 2020 of $400,000, staff is proposing the following expenditures within thisbudget account:$65,000 Contractor patching$65,000 Materials for asphalt and concrete repairs by PW staff$20,000 Restriping of streets$225,000 to $250,000 Seal coating and crack sealing of pavementsWith the increase in the 2020 budget for street preservation, the city can contract with an asphalt contractor to doabout 2 to 3 weeks of patching. Attached is a drawing showing the areas that a contractor would do in the earlyspring. Staff would do the patching for the rest of the community. Staff believes with the added sweeper, addedperson in the street maintenance area, and assistance with an asphalt contractor in spring, the patching of pavementscould be done by August 15, 2020 and earlier depending on the severity of the winter.Another benefit of getting the patching of streets done earlier is to free up street department staff to get to other tasksthat are backlogged due to the amount of street patching. Listed below are some of the tasks that need attention:Maintenance tasks backlog Maintain and clean deltas around inlets and outlets of ponds and wetland areasRepairing storm pipes, manholes, catch basinsRepairing low manhole covers in the streetsReplace and repair broken sidewalksTrail patchingRemoving diseased and dangerous trees as well as maintaining tree trimming for sight line issuesCurrently the city only cleans 12 ponds per year which we currently have 260 ponds in the cityCurrently the street/surface water division only can inspect and maintain a quarter of the city’s 157 sumpmanholes per year, which is the minimum requirement for the NPDES Phase 2 permitThe city is not currently in compliance with the retroreflective street sign inspectionsRemoval of volunteer tree growth around storm water pondsFund additional park maintenance employee ($80,000):The Park Maintenance Division is currently comprised of seven fulltime employees (FTE): Five Light EquipmentOperators, a Park Foreman and a Superintendent. Fulltime staffing levels in this division have not increased in 21years. But the city’s park and trail system and associated maintenance responsibilities have approximately doubled insize over that same time period. The last time fulltime positions were added was in 1998 with two park maintenancepositions. As the city’s park system infrastructure continues to age and deteriorate, it has become all but impossible toadequately meet citizen expectations with current staffing levels. The addition of another FTE would increase the ParkMaintenance Division’s ability to complete the following required tasks in a more timely and efficient manner: mowingand maintaining all city parks, street boulevards and the downtown; park shelter maintenance; ball field grooming;fence repair; field striping; snow removal; ice hockey and ice rink maintenance; tree pruning; fertilizing; herbicideapplications; irrigation repair; and special event preparation and execution. Fund half time fire department admin position at full time ($37,000):This position has been a contracted employee for the past four years. The Shared Service Agreement (SSA) was created to incentivize a longterm, parttime Excelsior employee to stay working in a unique field. Within the agreement, the position made a full time Excelsior Fire District (EFD) employee with Chanhassen paying half off the total cost. The Excelsior Fire District advised the employee of moving that position to full time to be used solely by the Excelsior Fire District in the immediate future. Since implementing this position, the employee’s experience has tremendously assisted the fire chief and the overall administrative functions of the fire department. The role has expanded to assisting with a variety of other functions of the fire department and some work for the relief association. The employee has since obtained medical certification and assists on daytime medical calls augmenting short staffing during the week. The employee has expressed interest in obtaining full fire certifications to respond to all calls during the week. Further assistance is also needed in commercial inspections with fire certifications, this would allow for this employee to expand into those roles in down times during the work day. Fund additional Pavement Management Levy Needed for $3.6M/year ($350,000): A levy increase of $350,000 is needed to fund the Pavement Management Fund at $3.6M/year in mill and overlay and reconstruction improvements. The justification for this need has been thoroughly vetted and discussed by the city council and a franchise fee has already been approved to achieve the goal of $3.6M/year. Fund permanent revenue stream for Park Equipment Replacement Fund ($250,000): On the consent agenda this evening staff will be recommending the transfer of the remaining 2018 General Fund Surplus ($350,000). This transfer will keep the annual park equipment replacement schedule of $250,000/year funded thru 2021. The park master plan recommended the replacement of these important infrastructure items in our park system. A permanent funding source will need to be found by the time of the 2022 levy year. DISCUSSION Staff is looking for direction on which items to include as part of the amount above new growth ($510,000) for setting the final levy on December 9th. ATTACHMENTS: General Fund Detailed Budget Levy Impact Schedule Pothole Patching Map History of Change in Levy Preliminary Levy PowerPoint Presentation Carver County Preliminary Levies Carver County Preliminary Tax Rates 2019 2020 % Change Operational & Capital Levies General Fund 8,810,333$ Capital Replacement 800,000 Revolving Imp Street Reconstruction 381,223 MSA (Sealcoating) 93,000 Total Operational & Capital Levies 10,084,556$ -$ -100.00% Debt Levies Public Works Facility 475,800 Library Referendum 459,512 Total Debt Levies 935,312$ -$ -100.00% Total All Levies 11,019,868$ -$ -100.00% 2020 Tax Levy Personal Materials Contractual Capital 2020 2019 %2018 Services & Supplies Services Outlay Total Total Change Actual General Government 1110 Legislative 46,700 - 81,600 - 128,300 128,300 0.00%127,686 1120 Administration 497,900 - 56,400 - 554,300 564,300 -1.77%527,332 1130 Finance 330,500 200 48,300 - 379,000 371,500 2.02%348,833 1140 Legal - - 200,000 - 200,000 200,000 0.00%191,253 1150 Property Assessment - - 161,000 - 161,000 156,000 3.21%152,430 1160 MIS 168,800 41,400 48,000 - 258,200 257,800 0.16%229,810 1170 City Hall 92,400 41,400 277,500 - 411,300 395,800 3.92%405,703 1180 Elections 26,000 4,000 18,000 - 48,000 48,000 0.00%38,829 1190 Library Building - 2,500 109,100 - 111,600 111,600 0.00%105,505 *Total 1,162,300 89,500 999,900 - 2,251,700 2,233,300 0.82%2,127,383 Law Enforcement 1210 Police Administration - 1,000 1,977,800 - 1,978,800 1,885,800 4.93%1,780,646 1220 Fire Prevention & Admin 1,012,200 45,100 152,000 - 1,209,300 1,020,000 18.56%1,008,779 1250 Code Enforcement 696,500 6,800 11,700 - 715,000 742,500 -3.70%651,006 1260 Community Service 57,200 1,200 5,400 - 63,800 60,800 4.93%55,873 *Total 1,765,900 54,100 2,146,900 - 3,966,900 3,709,100 6.95%3,496,303 Public Works 1310 Engineering 675,400 800 29,300 - 705,500 669,900 5.31%609,793 1320 Street Maintenance 876,000 115,300 43,400 - 1,034,700 1,015,100 1.93%1,003,974 1350 Street Lighting & Signals - 4,000 359,500 - 363,500 357,500 1.68%375,319 1370 Fleet Department 323,400 161,700 64,800 5,500 555,400 558,700 -0.59%550,586 *Total 1,874,800 281,800 497,000 5,500 2,659,100 2,601,200 2.23%2,539,672 Community Development 1410 Planning Commission - 200 1,500 - 1,700 1,700 0.00%828 1420 Planning Administration 519,600 400 11,500 - 531,500 540,900 -1.74%502,004 1430 Senior Commission 29,600 - 15,000 - 44,600 40,200 10.95%44,876 *Total 549,200 600 28,000 - 577,800 582,800 -0.86%547,708 Park & Recreation 1510 Park & Rec Commission - 200 1,000 - 1,200 1,200 0.00%25 1520 Park & Rec Administration 250,300 200 5,700 - 256,200 256,800 -0.23%235,876 1530 Recreation Center 234,500 17,700 94,400 - 346,600 346,800 -0.06%327,125 1540 Lake Ann Park Operations 12,300 10,200 48,600 - 71,100 68,800 3.34%64,106 1550 Park Maintenance 830,700 84,200 104,300 - 1,019,200 1,002,700 1.65%1,068,895 1560 Senior Citizens Center 84,500 4,300 30,700 - 119,500 121,700 -1.81%130,212 1600 Recreation Programs 257,500 22,300 128,800 - 408,600 393,560 3.82%362,400 1700 Self-Supporting Programs 21,000 3,300 12,500 - 36,800 38,400 -4.17%51,000 1800 Recreation Sports 30,400 7,900 300 - 38,600 38,600 0.00%31,653 *Total 1,721,200 150,300 426,300 - 2,297,800 2,268,560 1.29%2,271,291 Total Operational Expenditures 7,073,400 576,300 4,098,100 5,500 11,753,300 11,394,960 3.14%10,982,357 Transfer for Roads - - - - **Total General Fund 11,753,300 11,394,960 3.14%10,982,357 Dollar Change from Previous Year 358,340 2020 General Fund Budget Expenditures 2017 2018 2019 2020 Inc Over 2021 Account Description Actual Actual Budget Budget PY Budget Estimate General Property Tax 3010 Current Property Tax 8,475,905 8,679,991 8,810,333 9,021,833 2.4%9,122,300 3002 Allowance for Delinquent Taxes (75,108) (46,746) (70,000) (40,000) (60,000) 3011 Delinquent Property Tax 7,050 14,350 15,000 20,000 15,000 3090 Excess TIF Taxes 86,633 - - *Total General Property Tax 8,494,480 8,647,594 8,755,333 9,001,833 2.8%9,077,300 Licenses 3203 Dog Kennel 250 325 500 500 500 3206 Massage License 150 50 500 100 100 3213 Solicitor - - - - 3226 Liquor On and Off Sale 92,018 76,904 93,000 90,000 90,000 3284 Rubbish 3,000 1,200 3,500 3,000 3,000 *Total Licenses 95,418 78,479 97,500 93,600 -4.0%93,600 Permits 3301 Building 518,620 778,694 520,000 520,000 565,000 3302 Plan Check 253,777 428,932 255,000 255,000 278,000 3305 Heating & A/C 172,701 183,881 119,300 119,300 140,000 3306 Plumbing 97,615 149,778 90,000 90,000 95,000 3307 Trenching 55,066 54,154 30,000 30,000 35,000 3308 Hunting/Shooting 840 700 1,400 1,400 700 3309 Sprinkler 11,074 16,664 11,000 11,000 11,000 3311 Sign 4,015 8,280 5,000 5,000 5,000 3316 Septic Tank - 222 - - - 3320 Stable 200 190 300 300 300 3331 Firework's Application Fee 200 200 - - - 3390 Misc. Permits 5,525 4,545 3,000 3,000 5,000 *Total Permits 1,119,633 1,626,240 1,035,000 1,035,000 0.0%1,135,000 Fines & Penalties 3401 Traffic & Ordinance Violation 126,636 93,455 115,000 115,000 115,000 3402 Vehicle Lockouts 950 1,400 1,000 1,000 1,000 3404 Dog/Cat Impound 808 496 500 500 500 3405 Other Fines and Penalties - - - - *Total Fines & Penalties 128,394 95,351 116,500 116,500 0.0%116,500 Intergovernmental Revenue 3503 Reimbursement from School Dist.49,407 51,233 45,000 55,000 52,000 3509 Other Shared Taxes 196,021 201,162 195,000 200,000 200,000 3510 Grants-State 163,912 176,847 160,000 180,000 180,000 3530 Grants-Federal - - - - - 3533 Grants-Other 6,291 7,016 - 7,000 5,000 *Total Intergovernmental Revenue 415,632 436,258 400,000 442,000 10.5%437,000 2020 General Fund Budget Revenue 2017 2018 2019 2020 Inc Over 2021 Account Description Actual Actual Budget Budget PY Budget Estimate Charges for Current Services 3601 Sale of Documents 950 779 800 800 800 3602 Use & Variance Permits 21,533 17,660 20,000 25,000 25,000 3603 Rezoning Fees 1,750 1,675 2,000 2,000 2,000 3604 Assessment Searches - 45 - - - 3605 Plat Recording Fees 2,290 1,537 3,000 2,000 2,000 3607 Election Filing Fees - 40 - - - 3613 Misc.-General Government 5,616 2,456 5,000 5,000 5,000 3614 Admin. Charge-2% Constr.52,225 10,806 50,000 50,000 50,000 3617 Engineering General - - - - - 3619 Investment Management Fee 75,000 75,000 75,000 75,000 75,000 3629 Misc.-Public Safety 9,971 8,412 10,000 10,000 10,000 3630 Recreation Program Fees 59,520 63,596 52,000 65,000 62,000 3631 Recreation Center 217,077 228,935 218,000 225,000 225,000 3633 Park Equipment Rental 93 34 100 100 100 3634 Park Facility Usage Fee 19,022 16,976 19,000 19,000 19,000 3635 Watercraft Rental 18,020 17,543 18,000 18,000 18,000 3636 Self-Supporting Programs 45,276 42,366 42,000 42,000 42,000 3637 Senior Programs 47,025 39,327 45,000 45,000 45,000 3638 Food Concessions 10,862 11,023 11,000 11,000 11,000 3639 Misc.-Park & Rec.1,347 1,345 1,200 1,200 1,200 3642 Recreation Sports 44,384 34,061 44,000 40,000 38,000 3649 Misc.-Public Works 3,651 1,038 2,000 2,000 2,000 3651 Merchandise Sales 2,950 2,339 2,800 2,800 2,800 *Total Charges for Current Services 638,562 576,992 620,900 640,900 3.2%635,900 Other Revenue 3801 Interest Earnings 36,120 73,165 30,000 50,000 50,000 3802 Equipment Rental & Sale 186,978 192,792 250,000 275,000 275,000 3803 Building Rental 5,798 5,849 5,800 5,800 5,800 3804 Land Sale 8,100 - - - - 3807 Donations 28,609 25,387 24,127 25,467 25,000 3808 Insurance Reimbursements 18,709 10,267 - 10,000 10,000 3816 SAC Retainer 4,386 8,449 4,000 6,000 6,000 3818 Sur-Tax Retainer 740 903 700 700 700 3820 Misc. Other Revenue 766 930 500 500 500 3903 Refunds/Reimbursements 55,635 50,160 55,000 50,000 50,000 3980 Cash Short/Over 1 (1) - - - *Total Other Revenue 345,843 367,900 370,127 423,467 14.4%423,000 **Total General Fund Revenue 11,237,962 11,828,816 11,395,360 11,753,300 3.1%11,918,300 Total General Fund Expenditures 11,753,300 Net Levy Remaining (Use of Gen Fund Reserves)- 2020 General Fund Budget Revenue 2019 to 2017 2018 2019 2020 2020 2021 Account Description Actual Actual Budget Budget % Inc/(Dec)Estimate 4020 Salaries & Wages-Temp 42,000 41,550 43,600 43,600 0.0%45,400 4030 Contributions-Retirement 2,804 2,769 3,000 3,000 0.0%3,200 4050 Workers Compensation 90 85 100 100 0.0%100 *Total Personal Services 44,894 44,404 46,700 46,700 0.0%48,700 4300 Fees, Services - - 1,000 1,000 0.0%1,000 4340 Printing & Publishing 29,911 33,838 32,000 32,000 0.0%33,000 4360 Subscriptions & Memberships 41,560 42,031 42,000 42,000 0.0%43,000 4370 Travel & Training 5,650 5,686 6,000 6,000 0.0%6,000 4375 Promotional Expenses 599 1,727 600 600 0.0%600 *Total Contractual Services 77,719 83,282 81,600 81,600 0.0%83,600 **Total Legislative 122,613 127,686 128,300 128,300 0.0%132,300 SIGNIFICANT CHANGES DESCRIPTION OF CHANGE 2020 2021 2020 General Fund Budget Legislative (1110) 2019 to 2017 2018 2019 2020 2020 2021 Account Description Actual Actual Budget Budget % Inc/(Dec)Estimate 4010 Salaries & Wages-Reg 360,011 357,790 377,300 378,700 0.4%390,000 4020 Salaries & Wages-Temp 209 2,331 300 300 0.0%300 4021 Overtime-Temp - 98 - - 0.0%- 4030 Contributions-Retirement 51,126 51,704 55,500 57,400 3.4%59,000 4040 Contributions-Insurance 59,127 63,824 68,000 58,000 (14.7%)64,300 4050 Workers Compensation 3,045 2,844 3,700 3,500 (5.4%)3,500 *Total Personal Services 473,517 478,591 504,800 497,900 (1.4%)517,100 4300 Fees, Services 4,634 3,685 15,000 10,000 (33.3%)12,000 4310 Telephone 5,677 4,752 5,800 5,800 0.0%5,800 4320 Utilities - 302 200 300 50.0%300 4330 Postage 22,968 22,500 23,000 23,000 0.0%23,000 4340 Printing & Publishing - 380 300 300 0.0%300 4360 Subscriptions & Memberships 4,633 5,238 4,600 5,000 8.7%5,000 4370 Travel & Training 9,503 10,115 8,600 10,000 16.3%10,000 4380 Mileage 1,079 1,349 1,000 1,200 20.0%1,200 4410 Rental-Equipment 860 420 1,000 800 (20.0%)800 *Total Contractual Services 49,355 48,741 59,500 56,400 (5.2%)58,400 **Total Administration 522,872 527,332 564,300 554,300 (1.8%)575,500 SIGNIFICANT CHANGES DESCRIPTION OF CHANGE 2020 2021 2020 General Fund Budget Adminstration (1120) 2019 to 2017 2018 2019 2020 2020 2021 Account Description Actual Actual Budget Budget % Inc/(Dec)Estimate 4010 Salaries & Wages-Reg 226,932 225,766 239,500 246,600 3.0%254,000 4030 Contributions-Retirement 33,129 31,855 36,300 37,400 3.0%38,500 4040 Contributions-Insurance 38,281 46,400 50,900 44,500 (12.6%)50,000 4050 Workers Compensation 1,937 1,778 2,300 2,000 (13.0%)2,000 *Total Personal Services 300,279 305,799 329,000 330,500 0.5%344,500 4120 Supplies-Equipment - 64 100 100 0.0%100 4210 Books & Periodicals - - 100 100 0.0%100 *Total Materials & Supplies - 64 200 200 0.0%200 4300 Fees, Services 14,087 10,447 16,000 16,000 0.0%16,000 4301 Fees, Financial/Audit 19,147 26,047 20,000 26,000 30.0%26,000 4310 Telephone and Communications 997 1,082 1,000 1,000 0.0%1,000 4340 Printing & Publishing 200 1,087 300 300 0.0%300 4360 Subscriptions & Memberships 465 425 500 500 0.0%500 4370 Travel & Training 3,926 3,883 4,500 4,500 0.0%4,500 *Total Contractual Services 38,821 42,970 42,300 48,300 14.2%48,300 **Total Finance 339,100 348,833 371,500 379,000 2.0%393,000 SIGNIFICANT CHANGES DESCRIPTION OF CHANGE 2020 Fees, Financial/Audit A small increase is included for the negotiated Audit Contract as well as new GASB Requirement for actuarial services related to pension reporting. 2021 2020 General Fund Budget Finance (1130) 2019 to 2017 2018 2019 2020 2020 2021 Account Description Actual Actual Budget Budget % Inc/(Dec)Estimate 4302 Fees, Legal 198,417 191,253 200,000 200,000 0.0%200,000 *Total Contractual Services 198,417 191,253 200,000 200,000 0.0%200,000 **Total Legal 198,417 191,253 200,000 200,000 0.0%200,000 SIGNIFICANT CHANGES DESCRIPTION OF CHANGE 2020 2021 2020 General Fund Budget Legal (1140) 2019 to 2017 2018 2019 2020 2020 2021 Account Description Actual Actual Budget Budget % Inc/(Dec)Estimate 4300 Fees, Services 146,422 152,430 156,000 161,000 3.2%166,000 *Total Contractual Services 146,422 152,430 156,000 161,000 3.2%166,000 **Total Property Assessment 146,422 152,430 156,000 161,000 3.2%166,000 SIGNIFICANT CHANGES DESCRIPTION OF CHANGE 2020 2021 2020 General Fund Budget Property Assessment (1150) 2019 to 2017 2018 2019 2020 2020 2021 Account Description Actual Actual Budget Budget % Inc/(Dec)Estimate 4010 Salaries & Wages-Reg 112,230 118,751 123,800 128,000 3.4%131,800 4030 Contributions-Retirement 16,505 17,286 18,800 19,400 3.2%20,000 4040 Contributions-Insurance 19,697 21,908 23,300 20,400 (12.4%)22,800 4050 Workers Compensation 957 935 1,200 1,000 (16.7%)1,000 *Total Personal Services 149,389 158,880 167,100 168,800 1.0%175,600 4150 Maintenance Materials 1,062 875 1,300 1,000 (23.1%)1,300 4210 Books & Periodicals 55 83 100 100 0.0%100 4220 Software Licensing & Support 27,670 24,100 43,000 40,000 (7.0%)35,000 4260 Small Tools & Equipment 274 35 300 300 0.0%300 *Total Materials & Supplies 29,061 25,093 44,700 41,400 (7.4%)36,700 4300 Fees, Services 21,368 21,846 22,000 24,000 9.1%22,000 4310 Telephone and Communications 1,980 1,700 2,000 2,000 0.0%2,000 4320 Utilities 11,070 10,998 11,000 11,000 0.0%11,000 4370 Travel & Training 5,755 7,465 6,000 6,000 0.0%6,000 4530 Repair & Maintenance-Equip 4,990 3,828 5,000 5,000 0.0%5,000 *Total Contractual Services 45,163 45,837 46,000 48,000 4.3%46,000 **Total MIS 223,613 229,810 257,800 258,200 0.2%258,300 SIGNIFICANT CHANGES DESCRIPTION OF CHANGE 2020 2021 2020 General Fund Budget Management Information Systems (MIS) (1160) 2019 to 2017 2018 2019 2020 2020 2021 Account Description Actual Actual Budget Budget % Inc/(Dec)Estimate 4010 Salaries & Wages-Reg 58,399 59,964 60,000 61,200 2.0%63,000 4011 Overtime-Reg - 965 1,000 1,000 0.0%1,000 4030 Contributions-Retirement 8,301 8,557 9,000 9,200 2.2%9,500 4040 Contributions-Insurance 14,691 18,183 19,300 17,000 (11.9%)19,000 4050 Workers Compensation 3,479 3,417 4,200 4,000 (4.8%)4,000 *Total Personal Services 84,870 91,086 93,500 92,400 (1.2%)96,500 4110 Supplies-Office 32,629 35,553 34,000 35,000 2.9%36,000 4120 Supplies-Equipment 176 8 900 500 (44.4%)500 4140 Supplies-Vehicles 411 453 500 500 0.0%500 4150 Maintenance Materials 4,250 5,576 4,500 5,000 11.1%5,000 4260 Small Tools & Equipment 144 56 400 400 0.0%400 *Total Materials & Supplies 37,611 41,645 40,300 41,400 2.7%42,400 4300 Fees, Services 11,166 11,442 11,000 12,000 9.1%12,000 4310 Telephone 10,357 10,424 11,000 10,500 (4.5%)11,000 4320 Utilities 37,768 39,509 39,000 39,000 0.0%41,000 4350 Cleaning & Waste Removal 29,201 30,434 30,000 31,000 3.3%32,000 4370 Travel & Training - - 200 200 0.0%200 4410 Rental-Equipment 14,442 12,342 14,500 14,500 0.0%14,500 4440 License & Registration - 32 100 100 0.0%100 4483 Insurance-General Liability 141,675 158,898 150,000 160,000 6.7%170,000 4510 Repair & Maintenance-Building 12,932 5,386 1,000 5,000 400.0%5,000 4520 Repair & Maintenance-Vehicles - - 200 200 0.0%200 4530 Repair & Maintenance-Equip 10,245 4,505 5,000 5,000 0.0%5,000 *Total Contractual Services 267,785 272,972 262,000 277,500 5.9%291,000 **Total City Hall 390,266 405,703 395,800 411,300 3.9%429,900 SIGNIFICANT CHANGES DESCRIPTION OF CHANGE 2020 2021 2020 General Fund Budget City Hall (1170) 2019 to 2017 2018 2019 2020 2020 2021 Account Description Actual Actual Budget Budget % Inc/(Dec)Estimate 4020 Salaries & Wages-Temp - 27,088 26,000 26,000 0.0%28,000 4030 Contributions-Retirement - - - - 0.0%- 4050 Workers Compensation - - - - 0.0%- *Total Personal Services - 27,088 26,000 26,000 0.0%28,000 4110 Supplies-Office - 1,239 1,500 1,500 0.0%1,500 4120 Supplies-Equipment - 114 2,500 2,500 0.0%2,500 *Total Materials & Supplies - 1,352 4,000 4,000 0.0%4,000 4300 Fees, Services - 4,090 12,000 12,000 0.0%14,000 4340 Printing & Publishing - 447 1,000 1,000 0.0%1,000 4370 Travel & Training - 5,851 5,000 5,000 0.0%6,000 *Total Contractual Services - 10,388 18,000 18,000 0.0%21,000 **Total Elections - 38,829 48,000 48,000 0.0%53,000 SIGNIFICANT CHANGES DESCRIPTION OF CHANGE 2020 2021 2020 General Fund Budget Elections (1180) 2019 to 2017 2018 2019 2020 2020 2021 Account Description Actual Actual Budget Budget % Inc/(Dec)Estimate 4150 Maintenance Materials 2,333 50 2,500 2,500 0.0%2,500 *Total Materials & Supplies 2,333 50 2,500 2,500 0.0%2,500 4300 Fees, Services 3,258 7,191 3,000 4,000 33.3%5,000 4310 Telephone 1,526 1,526 1,600 1,600 0.0%1,700 4320 Utilities 56,908 58,149 63,000 60,000 (4.8%)60,000 4350 Cleaning & Waste Removal 29,304 33,301 30,500 32,500 6.6%33,000 4510 Repair & Maintenance-Building 10,274 4,954 6,500 6,500 0.0%6,500 4530 Repair & Maintenance-Equip 5,562 333 4,500 4,500 0.0%4,500 *Total Contractual Services 106,832 105,455 109,100 109,100 0.0%110,700 **Total Library Building 109,165 105,505 111,600 111,600 0.0%113,200 SIGNIFICANT CHANGES DESCRIPTION OF CHANGE 2020 2021 2020 General Fund Budget Library Building (1190) 2019 to 2017 2018 2019 2020 2020 2021 Account Description Actual Actual Budget Budget % Inc/(Dec)Estimate 4010 Salaries & Wages-Reg 5,209 - - - 0.0%- 4030 Contributions-Retirement 766 - - - 0.0%- 4040 Contributions-Insurance 1,442 - - - 0.0%- 4050 Workers Compensation 45 - - - 0.0%- *Total Personal Services 7,463 - - - 0.0%- 4130 Program Supplies 313 342 1,000 1,000 0.0%- *Total Materials & Supplies 313 342 1,000 1,000 0.0%- 4300 Fees, Services 1,795,040 1,779,397 1,882,700 1,976,700 5.0%2,075,500 4370 Travel & Training 15 90 100 100 0.0%100 4375 Promotional Expense 1,405 817 2,000 1,000 (50.0%)1,000 *Total Contractual Services 1,796,460 1,780,303 1,884,800 1,977,800 4.9%2,076,600 **Total Police Administration 1,804,236 1,780,646 1,885,800 1,978,800 4.9%2,076,600 SIGNIFICANT CHANGES DESCRIPTION OF CHANGE 2020 2021 2020 General Fund Budget Police Administration (1210) 2019 to 2017 2018 2019 2020 2020 2021 Account Description Actual Actual Budget Budget % Inc/(Dec)Estimate 4010 Salaries & Wages-Reg 217,749 205,907 217,000 225,200 3.8%232,000 4011 Overtime-Reg 292 2,724 3,000 3,000 0.0%3,000 4020 Salaries & Wages-Temp 153,469 208,252 200,000 345,000 72.5%350,000 4030 Contributions-Retirement 222,858 232,909 230,000 252,000 9.6%255,000 4031 Fire Relief Required Contribution - 54,749 40,000 50,000 25.0%50,000 4040 Contributions-Insurance 25,335 22,068 23,500 21,000 (10.6%)23,000 4050 Workers Compensation 71,572 68,767 75,000 80,000 6.7%80,000 4060 Unemployment 439 36 - - 0.0%- 4070 Contracted Wages 34,048 34,048 36,000 36,000 0.0%38,000 *Total Personal Services 725,763 829,461 824,500 1,012,200 22.8%1,031,000 4120 Supplies-Equipment 6,994 7,015 7,000 7,000 0.0%7,000 4130 Supplies-Program 3,073 3,282 2,200 2,200 0.0%2,200 4140 Supplies-Vehicles 6,943 4,310 9,000 9,000 0.0%9,000 4150 Maintenance Materials 1 164 400 400 0.0%400 4210 Books & Periodicals - - 500 500 0.0%500 4240 Uniforms & Clothing 9,044 9,853 11,000 11,000 0.0%11,000 4260 Small Tools & Equipment 4,924 8,166 8,000 8,000 0.0%8,000 4290 Misc. Materials & Supplies 3,642 6,407 7,000 7,000 0.0%7,000 *Total Materials & Supplies 34,620 39,197 45,100 45,100 0.0%45,100 4300 Fees, Services 29,088 26,056 32,000 34,000 6.3%35,500 4310 Telephone 8,541 7,815 8,000 8,000 0.0%8,000 4320 Utilities 15,464 18,392 16,000 17,000 6.3%17,000 4350 Cleaning & Waste Removal 4,469 5,606 5,100 5,100 0.0%5,100 4360 Subscriptions & Memberships 1,327 1,452 2,000 2,000 0.0%2,000 4370 Travel & Training 40,072 43,692 41,500 41,500 0.0%41,500 4375 Promotional Expense 6,922 7,415 10,000 8,000 (20.0%)8,000 4483 Insurance-General Liability 734 1,175 800 2,400 200.0%2,400 4510 Repair & Maintenance-Building 5,775 7,544 5,500 5,500 0.0%5,500 4520 Repair & Maintenance-Vehicles 1,909 100 7,000 4,000 (42.9%)4,000 4530 Repair & Maintenance-Equip 20,338 20,367 20,500 22,500 9.8%23,600 4531 Repair & Maintenance-Radios 63 508 2,000 2,000 0.0%2,000 *Total Contractual Services 134,704 140,122 150,400 152,000 1.1%154,600 **Total Fire Prevention and Admin 895,087 1,008,779 1,020,000 1,209,300 18.6%1,230,700 SIGNIFICANT CHANGES DESCRIPTION OF CHANGE 2020 2021 2020 General Fund Budget Fire Prevention and Administration (1220) 2019 to 2017 2018 2019 2020 2020 2021 Account Description Actual Actual Budget Budget % Inc/(Dec)Estimate 4010 Salaries & Wages-Reg 537,534 474,940 504,000 515,700 2.3%531,200 4011 Overtime-Reg 82 310 - - 0.0%- 4020 Salaries & Wages-Temp 14,490 972 18,000 1,000 (94.4%)1,000 4030 Contributions-Retirement 75,207 70,259 76,400 78,000 2.1%80,500 4040 Contributions-Insurance 96,731 88,481 120,300 98,200 (18.4%)110,000 4050 Workers Compensation 3,575 3,298 4,200 3,600 (14.3%)3,800 *Total Personal Services 727,619 638,260 722,900 696,500 (3.7%)726,500 4120 Supplies-Equipment - - 100 100 0.0%100 4130 Supplies-Program 877 689 900 800 (11.1%)800 4140 Supplies-Vehicles 279 891 2,000 1,500 (25.0%)1,500 4210 Books & Periodicals 77 331 1,500 2,500 66.7%2,500 4240 Uniforms & Clothing 956 1,242 1,500 1,500 0.0%1,500 4260 Small Tools & Equipment 344 74 400 400 0.0%400 *Total Materials & Supplies 2,534 3,227 6,400 6,800 6.3%6,800 4310 Telephone 2,535 2,736 4,500 3,000 (33.3%)3,000 4340 Printing & Publishing - 594 1,000 1,000 0.0%1,000 4360 Subscriptions & Memberships 761 1,120 1,000 1,000 0.0%1,000 4370 Travel & Training 3,336 4,973 5,000 5,000 0.0%5,000 4440 License & Registration - 96 500 500 0.0%500 4520 Repair & Maintenance-Vehicles - - 300 300 0.0%300 4530 Repair & Maintenance-Equip - - 900 900 0.0%900 *Total Contractual Services 6,632 9,518 13,200 11,700 (11.4%)11,700 **Total Code Enforcement 736,784 651,006 742,500 715,000 (3.7%)745,000 SIGNIFICANT CHANGES DESCRIPTION OF CHANGE 2020 2021 2020 General Fund Budget Code Enforcement (1250) 2019 to 2017 2018 2019 2020 2020 2021 Account Description Actual Actual Budget Budget % Inc/(Dec)Estimate 4020 Salaries & Wages-Temp 35,473 42,434 45,500 48,000 5.5%50,000 4021 Overtime-Temp 289 83 300 300 0.0%300 4030 Contributions-Retirement 4,576 6,490 6,000 7,000 16.7%7,500 4040 Contributions-Insurance 321 590 600 600 0.0%600 4050 Workers Compensation 1,115 1,280 1,300 1,300 0.0%1,300 4060 Unemployment 527 524 - - 0.0%- *Total Personal Services 42,302 51,400 53,700 57,200 6.5%59,700 4120 Supplies-Equipment 175 116 300 300 0.0%300 4140 Supplies-Vehicles 17 105 700 200 (71.4%)300 4240 Uniforms & Clothing 801 250 700 700 0.0%700 *Total Materials & Supplies 993 470 1,700 1,200 (29.4%)1,300 4300 Fees, Services 4,126 2,757 3,200 3,200 0.0%3,200 4310 Telephone 1,229 1,245 1,600 1,600 0.0%1,600 4340 Printing & Publishing 16 - 100 100 0.0%- 4520 Repair & Maintenance-Vehicles - - 200 200 0.0%- 4530 Repair & Maintenance-Equip - - 100 100 0.0%- 4531 Repair & Maintenance-Radios - - 200 200 0.0%- *Total Contractual Services 5,370 4,002 5,400 5,400 0.0%4,800 **Total Community Service 48,665 55,873 60,800 63,800 4.9%65,800 SIGNIFICANT CHANGES DESCRIPTION OF CHANGE 2020 2021 2020 General Fund Budget Community Service (1260) 2019 to 2017 2018 2019 2020 2020 2021 Account Description Actual Actual Budget Budget % Inc/(Dec)Estimate 4010 Salaries & Wages-Reg 464,860 419,427 473,000 491,800 4.0%506,500 4011 Overtime-Reg 6,157 7,436 6,000 7,000 16.7%7,000 4020 Salaries & Wages-Temp 13,897 7,047 14,000 12,000 (14.3%)12,000 4021 Overtime-Temp - 51 - - 0.0%- 4030 Contributions-Retirement 68,941 62,455 71,700 74,500 3.9%78,000 4040 Contributions-Insurance 80,702 78,157 73,500 86,600 17.8%97,000 4050 Workers Compensation 3,588 2,833 4,000 3,500 (12.5%)3,500 *Total Personal Services 638,144 577,405 642,200 675,400 5.2%704,000 4120 Supplies-Equipment 21 399 500 500 0.0%500 4140 Supplies-Vehicles 10 416 300 300 0.0%300 *Total Materials & Supplies 32 814 800 800 0.0%800 4300 Fees, Services 10,822 23,254 16,000 16,000 0.0%16,000 4310 Telephone 3,915 4,350 4,000 4,600 15.0%4,600 4340 Printing & Publishing 292 358 300 300 0.0%300 4360 Subscriptions & Memberships 1,383 1,280 1,500 1,500 0.0%1,500 4370 Travel & Training 3,971 2,331 4,500 6,300 40.0%6,300 4380 Mileage 149 - 100 100 0.0%100 4530 Repair & Maintenance-Equip - - 500 500 0.0%500 *Total Contractual Services 20,533 31,573 26,900 29,300 8.9%29,300 **Total Engineering 658,709 609,793 669,900 705,500 5.3%734,100 SIGNIFICANT CHANGES DESCRIPTION OF CHANGE 2020 2021 2020 General Fund Budget Engineering (1310) 2019 to 2017 2018 2019 2020 2020 2021 Account Description Actual Actual Budget Budget % Inc/(Dec)Estimate 4010 Salaries & Wages-Reg 489,181 493,599 543,100 560,500 3.2%577,000 4011 Overtime-Reg 27,554 65,137 27,000 40,000 48.1%45,000 4020 Salaries & Wages-Temp 24,366 27,994 28,000 32,000 14.3%34,000 4021 Overtime-Temp 428 438 - - 0.0%- 4030 Contributions-Retirement 77,435 84,190 82,300 86,000 4.5%88,000 4040 Contributions-Insurance 100,282 119,357 120,000 97,500 (18.8%)109,000 4050 Workers Compensation 59,215 58,393 66,000 60,000 (9.1%)62,000 4060 Unemployment 3,328 4,008 - - 0.0%- *Total Personal Services 781,789 853,116 866,400 876,000 1.1%915,000 4120 Supplies-Equipment 43,237 38,254 45,000 40,000 (11.1%)45,000 4140 Supplies-Vehicles 18,263 9,420 12,000 12,000 0.0%12,000 4150 Maintenance Materials 33,014 50,856 48,000 55,000 14.6%55,000 4210 Books & Periodicals - - 100 100 0.0%100 4240 Uniforms & Clothing 5,439 4,308 5,500 5,500 0.0%5,500 4260 Small Tools & Equipment 2,758 1,706 2,700 2,700 0.0%2,700 *Total Materials & Supplies 102,710 104,543 113,300 115,300 1.8%120,300 4300 Fees, Services 9,353 3,953 3,500 3,500 0.0%3,500 4310 Telephone 5,128 8,299 5,200 8,300 59.6%9,100 4340 Printing & Publishing 63 173 300 300 0.0%300 4350 Cleaning & Waste Removal 2,051 522 2,000 2,000 0.0%2,000 4360 Subscriptions & Memberships - 100 200 100 (50.0%)100 4370 Travel & Training 1,589 2,111 1,600 1,600 0.0%1,600 4410 Rental-Equipment 8,383 8,260 3,000 8,000 166.7%8,000 4440 License & Registration 5 464 500 500 0.0%500 4510 Repair & Maintenance-Building 450 16 100 100 0.0%100 4520 Repair & Maintenance-Vehicles 200 2,824 800 800 0.0%800 4530 Repair & Maintenance-Equip 650 2,250 700 700 0.0%700 4540 Repair & Maintenance-Streets 6,875 5,800 6,500 6,500 0.0%6,500 4560 Repair & Maintenance-Signs 11,850 11,544 11,000 11,000 0.0%11,000 *Total Contractual Services 46,597 46,316 35,400 43,400 22.6%44,200 **Total Street Maintenance 931,096 1,003,974 1,015,100 1,034,700 1.9%1,079,500 SIGNIFICANT CHANGES DESCRIPTION OF CHANGE 2020 2021 2020 General Fund Budget Street Maintenance (1320) 2019 to 2017 2018 2019 2020 2020 2021 Account Description Actual Actual Budget Budget % Inc/(Dec)Estimate 4120 Supplies-Equipment 4,679 5,233 3,000 4,000 33.3%5,000 *Total Materials & Supplies 4,679 5,233 3,000 4,000 33.3%5,000 4300 Fees, Services 2,166 - 1,000 1,000 0.0%1,000 4310 Telephone 360 360 500 500 0.0%500 4320 Utilities 320,328 328,234 323,000 323,000 0.0%332,000 4565 Repair & Maintenance-Light/Signal 31,664 41,492 30,000 35,000 16.7%40,000 *Total Contractual Services 354,518 370,086 354,500 359,500 1.4%373,500 **Total Street Lighting and Signals 359,197 375,319 357,500 363,500 1.7%378,500 SIGNIFICANT CHANGES DESCRIPTION OF CHANGE 2020 2021 2020 General Fund Budget Street Lighting and Signals (1350) 2019 to 2017 2018 2019 2020 2020 2021 Account Description Actual Actual Budget Budget % Inc/(Dec)Estimate 4010 Salaries & Wages-Reg 206,685 213,491 217,100 224,400 3.4%231,100 4011 Overtime-Reg 4,771 14,072 5,000 7,000 40.0%9,000 4020 Salaries & Wages-Temp 4,182 4,500 5,000 5,000 0.0%5,500 4021 Overtime-Temp - 127 - - 0.0%- 4030 Contributions-Retirement 30,569 32,815 33,000 35,000 6.1%36,000 4040 Contributions-Insurance 40,026 44,291 48,300 42,000 (13.0%)47,000 4050 Workers Compensation 9,266 9,276 11,000 10,000 (9.1%)10,000 *Total Personal Services 295,498 318,572 319,400 323,400 1.3%338,600 4120 Supplies-Equipment 1,610 502 2,000 1,600 (20.0%)1,600 4140 Supplies-Vehicles 48 60 200 200 0.0%200 4150 Maintenance Materials 113 2,058 600 600 0.0%600 4170 Motor Fuels & Lubricants 144,222 142,536 165,000 155,000 (6.1%)155,000 4240 Uniforms & Clothing 1,055 1,104 1,200 1,300 8.3%1,300 4260 Small Tools & Equipment 2,605 2,293 3,000 3,000 0.0%3,000 *Total Materials & Supplies 149,654 148,552 172,000 161,700 (6.0%)161,700 4300 Fees, Services 4,798 3,539 5,000 4,000 (20.0%)4,000 4310 Telephone 2,432 2,375 2,500 2,500 0.0%2,500 4320 Utilities 32,540 36,441 32,000 36,000 12.5%36,000 4350 Cleaning & Waste Removal 5,145 5,342 5,500 5,500 0.0%5,500 4360 Subscriptions & Memberships 40 40 200 200 0.0%200 4370 Travel & Training 691 - 800 800 0.0%800 4440 License & Registration - 425 300 300 0.0%300 4510 Repair & Maintenance-Building 12,451 31,448 12,000 12,000 0.0%12,000 4530 Repair & Maintenance-Equip 8,798 291 3,500 3,500 0.0%3,500 *Total Contractual Services 66,895 79,901 61,800 64,800 4.9%64,800 4703 Office Equipment - - 500 500 0.0%500 4705 Other Equipment 6,761 3,561 5,000 5,000 0.0%5,000 *Total Capital Outlay 6,761 3,561 5,500 5,500 0.0%5,500 **Total Fleet Department 518,808 550,586 558,700 555,400 (0.6%)570,600 SIGNIFICANT CHANGES DESCRIPTION OF CHANGE 2020 2021 2020 General Fund Budget Fleet Department (1370) 2019 to 2017 2018 2019 2020 2020 2021 Account Description Actual Actual Budget Budget % Inc/(Dec)Estimate 4210 Books & Periodicals - - 200 200 0.0%200 *Total Materials & Supplies - - 200 200 0.0%200 4340 Printing & Publishing 1,090 702 1,000 1,000 0.0%1,000 4360 Subscriptions & Memberships - - 200 200 0.0%200 4370 Travel & Training 249 126 300 300 0.0%300 *Total Contractual Services 1,338 828 1,500 1,500 0.0%1,500 **Total Planning Commission 1,338 828 1,700 1,700 0.0%1,700 SIGNIFICANT CHANGES DESCRIPTION OF CHANGE 2020 2021 2020 General Fund Budget Planning Commission (1410) 2019 to 2017 2018 2019 2020 2020 2021 Account Description Actual Actual Budget Budget % Inc/(Dec)Estimate 4010 Salaries & Wages-Reg 339,898 366,597 403,400 402,300 (0.3%)414,400 4011 Overtime-Reg - 1,410 - - 0.0%- 4030 Contributions-Retirement 48,624 52,927 61,000 61,000 0.0%63,000 4040 Contributions-Insurance 62,321 65,198 61,000 53,300 (12.6%)60,000 4050 Workers Compensation 2,860 2,888 3,800 3,000 (21.1%)3,200 *Total Personal Services 453,704 489,020 529,200 519,600 (1.8%)540,600 4120 Supplies-Equipment 62 66 300 100 (66.7%)100 4140 Supplies-Vehicles 441 284 100 300 200.0%300 *Total Materials & Supplies 503 350 400 400 0.0%400 4300 Fees, Services 37,392 10,354 5,000 5,000 0.0%5,000 4360 Subscriptions & Memberships 909 1,894 800 2,000 150.0%2,000 4370 Travel & Training 3,722 385 5,500 4,500 (18.2%)4,500 *Total Contractual Services 42,024 12,633 11,300 11,500 1.8%11,500 **Total Planning Administration 496,230 502,004 540,900 531,500 (1.7%)552,500 SIGNIFICANT CHANGES DESCRIPTION OF CHANGE 2020 2021 2020 General Fund Budget Planning Administration (1420) 2019 to 2017 2018 2019 2020 2020 2021 Account Description Actual Actual Budget Budget % Inc/(Dec)Estimate 4010 Salaries & Wages-Reg 21,852 22,594 22,600 23,300 3.1%24,000 4030 Contributions-Retirement 3,220 3,305 3,500 3,500 0.0%3,600 4040 Contributions-Insurance 2,481 2,748 2,900 2,600 (10.3%)2,900 4050 Workers Compensation 182 177 200 200 0.0%200 *Total Personal Services 27,735 28,824 29,200 29,600 1.4%30,700 4300 Fees, Services 14,240 14,737 10,000 14,000 40.0%14,000 4370 Travel & Training 295 - 200 200 0.0%200 4375 Promotional Expense 984 1,316 800 800 0.0%1,000 *Total Contractual Services 15,519 16,052 11,000 15,000 36.4%15,200 **Total Senior Commission 43,254 44,876 40,200 44,600 10.9%45,900 SIGNIFICANT CHANGES DESCRIPTION OF CHANGE 2020 2021 2020 General Fund Budget Senior Commission (1430) 2019 to 2017 2018 2019 2020 2020 2021 Account Description Actual Actual Budget Budget % Inc/(Dec)Estimate 4130 Supplies-Program - 25 100 100 0.0%100 4210 Books & Periodicals - - 100 100 0.0%100 *Total Materials & Supplies - 25 200 200 0.0%200 4340 Printing & Publishing - - 100 100 0.0%100 4360 Subscriptions & Memberships - - 500 500 0.0%500 4370 Travel & Training 175 - 400 400 0.0%400 *Total Contractual Services 175 - 1,000 1,000 0.0%1,000 **Total Park and Rec Commission 175 25 1,200 1,200 0.0%1,200 SIGNIFICANT CHANGES DESCRIPTION OF CHANGE 2020 2021 2020 General Fund Budget Park and Recreation Commission (1510) 2019 to 2017 2018 2019 2020 2020 2021 Account Description Actual Actual Budget Budget % Inc/(Dec)Estimate 4010 Salaries & Wages-Reg 172,863 168,124 182,300 186,700 2.4%192,300 4030 Contributions-Retirement 25,112 23,811 27,600 28,200 2.2%29,100 4040 Contributions-Insurance 26,993 36,543 38,900 33,900 (12.9%)39,000 4050 Workers Compensation 1,452 1,331 1,800 1,500 (16.7%)1,500 *Total Personal Services 226,420 229,809 250,600 250,300 (0.1%)261,900 4120 Supplies-Equipment 16 - 100 100 0.0%100 4130 Supplies-Program - 324 100 100 0.0%100 *Total Materials & Supplies 16 324 200 200 0.0%200 4300 Fees, Services 828 - 300 300 0.0%300 4310 Telephone 617 998 700 700 0.0%700 4360 Subscriptions & Memberships 3,448 2,716 3,100 2,800 (9.7%)2,800 4370 Travel & Training 1,821 2,029 1,800 1,800 0.0%1,800 4380 Mileage - - 100 100 0.0%100 *Total Contractual Services 6,713 5,743 6,000 5,700 (5.0%)5,700 **Total Park and Rec Admin.233,149 235,876 256,800 256,200 (0.2%)267,800 SIGNIFICANT CHANGES DESCRIPTION OF CHANGE 2020 2021 2020 General Fund Budget Park and Recreation Administration (1520) 2019 to 2017 2018 2019 2020 2020 2021 Account Description Actual Actual Budget Budget % Inc/(Dec)Estimate 4010 Salaries & Wages-Reg 64,313 66,539 68,100 70,800 4.0%73,000 4020 Salaries & Wages-Temp 97,000 103,816 113,000 113,000 0.0%116,000 4030 Contributions-Retirement 24,008 25,377 30,000 30,000 0.0%30,000 4040 Contributions-Insurance 9,848 10,920 11,600 10,200 (12.1%)12,000 4050 Workers Compensation 9,909 9,667 10,500 10,500 0.0%10,500 *Total Personal Services 205,079 216,319 233,200 234,500 0.6%241,500 4120 Supplies-Equipment 1,358 1,678 1,600 1,600 0.0%1,600 4130 Supplies-Program 13,066 14,884 15,000 15,000 0.0%15,000 4150 Maintenance Materials 450 248 500 500 0.0%500 4240 Uniforms & Clothing 631 500 600 600 0.0%600 *Total Materials & Supplies 15,505 17,310 17,700 17,700 0.0%17,700 4300 Fees, Services 50,812 50,977 52,000 51,000 (1.9%)52,000 4310 Telephone 917 618 1,000 1,000 0.0%1,000 4320 Utilities 35,409 37,345 37,000 37,000 0.0%38,000 4360 Subscriptions & Memberships 351 410 400 400 0.0%400 4370 Travel & Training 15 30 400 400 0.0%400 4375 Promotional Expense 700 890 800 800 0.0%800 4510 Repair & Maintenance-Building 1,978 1,745 2,500 2,000 (20.0%)2,000 4530 Repair & Maintenance-Equip 1,653 1,481 1,800 1,800 0.0%2,000 *Total Contractual Services 91,834 93,496 95,900 94,400 (1.6%)96,600 **Total Recreation Center 312,419 327,125 346,800 346,600 (0.1%)355,800 SIGNIFICANT CHANGES DESCRIPTION OF CHANGE 2020 2021 2020 General Fund Budget Recreation Center (1530) 2019 to 2017 2018 2019 2020 2020 2021 Account Description Actual Actual Budget Budget % Inc/(Dec)Estimate 4020 Salaries & Wages-Temp 8,164 9,121 10,700 11,000 2.8%11,400 4021 Overtime-Temp - 8 - - 0.0%- 4030 Contributions-Retirement 625 698 700 700 0.0%800 4050 Workers Compensation 500 523 600 600 0.0%600 *Total Personal Services 9,288 10,351 12,000 12,300 2.5%12,800 4130 Supplies-Program 10,477 8,143 9,000 10,000 11.1%10,000 4240 Uniforms & Clothing 200 200 200 200 0.0%200 *Total Materials & Supplies 10,677 8,343 9,200 10,200 10.9%10,200 4300 Fees, Services 35,341 32,346 35,000 35,000 0.0%35,000 4310 Telephone 1,288 1,145 1,200 1,200 0.0%1,200 4320 Utilities 10,765 11,642 11,000 12,000 9.1%12,000 4340 Printing & Publishing 214 268 400 400 0.0%400 4903 Bad Debt Expense - 12 - - 0.0%- *Total Contractual Services 47,607 45,413 47,600 48,600 2.1%48,600 **Total Lake Ann Park Operations 67,573 64,106 68,800 71,100 3.3%71,600 SIGNIFICANT CHANGES DESCRIPTION OF CHANGE 2020 2021 2020 General Fund Budget Lake Ann Park Operations (1540) 2019 to 2017 2018 2019 2020 2020 2021 Account Description Actual Actual Budget Budget % Inc/(Dec)Estimate 4010 Salaries & Wages-Reg 489,295 500,639 457,100 458,000 0.2%471,800 4011 Overtime-Reg 32,956 46,899 30,000 40,000 33.3%46,000 4020 Salaries & Wages-Temp 112,282 119,810 118,000 126,000 6.8%133,000 4021 Overtime-Temp 3,829 4,776 5,000 5,000 0.0%5,000 4030 Contributions-Retirement 83,513 86,052 88,000 91,000 3.4%95,000 4040 Contributions-Insurance 78,394 81,739 84,000 73,700 (12.3%)82,000 4050 Workers Compensation 36,995 35,687 39,000 37,000 (5.1%)38,000 *Total Personal Services 837,263 875,602 821,100 830,700 1.2%870,800 4120 Supplies-Equipment 45,221 41,455 40,000 41,000 2.5%41,000 4140 Supplies-Vehicles 11,122 3,049 5,000 5,000 0.0%5,000 4150 Maintenance Materials 21,561 35,339 27,000 30,000 11.1%30,000 4151 Irrigation Materials 3,967 1,515 5,000 4,000 (20.0%)4,000 4240 Uniforms & Clothing 2,453 3,304 2,600 3,000 15.4%3,000 4260 Small Tools & Equipment 2,032 1,022 1,200 1,200 0.0%1,200 *Total Materials & Supplies 86,356 85,684 80,800 84,200 4.2%84,200 4300 Fees, Services 52,825 46,982 43,000 45,000 4.7%45,000 4310 Telephone 5,813 6,704 5,900 6,200 5.1%6,200 4320 Utilities 4,796 5,220 4,800 5,200 8.3%5,200 4340 Printing & Publishing 105 254 200 200 0.0%200 4350 Cleaning & Waste Removal 3,591 3,932 3,700 3,900 5.4%3,900 4360 Subscriptions & Memberships - - 400 400 0.0%400 4370 Travel & Training 2,537 684 1,000 1,000 0.0%1,000 4400 Rental-Land & Buildings 29,984 34,853 36,000 35,000 (2.8%)36,000 4410 Rental-Equipment 1,274 973 700 1,000 42.9%1,000 4440 License & Registration 44 368 300 300 0.0%300 4510 Repair & Maintenance-Building 5,073 134 1,700 1,500 (11.8%)1,500 4520 Repair & Maintenance-Vehicles 2,387 - 100 100 0.0%100 4530 Repair & Maintenance-Equip 8,889 6,344 1,000 3,000 200.0%3,000 4560 Repair & Maintenance-Signs 754 1,159 2,000 1,500 (25.0%)1,500 *Total Contractual Services 118,073 107,608 100,800 104,300 3.5%105,300 **Total Park Maintenance 1,041,692 1,068,895 1,002,700 1,019,200 1.6%1,060,300 SIGNIFICANT CHANGES DESCRIPTION OF CHANGE 2020 2021 2020 General Fund Budget Park Maintenance (1550) 2019 to 2017 2018 2019 2020 2020 2021 Account Description Actual Actual Budget Budget % Inc/(Dec)Estimate 4010 Salaries & Wages-Reg 64,425 77,833 56,200 58,100 3.4%60,000 4030 Contributions-Retirement 9,772 8,907 8,600 8,900 3.5%9,000 4040 Contributions-Insurance 3,536 10,900 19,300 16,900 (12.4%)19,000 4050 Workers Compensation 535 493 600 600 0.0%600 *Total Personal Services 78,268 98,133 84,700 84,500 (0.2%)88,600 4120 Supplies-Equipment 41 116 300 300 0.0%300 4130 Supplies-Program 4,431 3,688 4,000 4,000 0.0%4,000 *Total Materials & Supplies 4,472 3,804 4,300 4,300 0.0%4,300 4300 Fees, Services 34,713 27,561 32,000 30,000 (6.3%)30,000 4310 Telephone - 180 - - 0.0%- 4350 Cleaning & Waste Removal 95 98 100 100 0.0%100 4360 Subscriptions & Memberships 110 110 100 100 0.0%100 4370 Travel & Training 222 233 300 300 0.0%300 4375 Promotional Expense 60 11 100 100 0.0%100 4380 Mileage - 82 100 100 0.0%100 *Total Contractual Services 35,200 28,275 32,700 30,700 (6.1%)30,700 **Total Senior Citizens Center 117,940 130,212 121,700 119,500 (1.8%)123,600 SIGNIFICANT CHANGES DESCRIPTION OF CHANGE 2020 2021 2020 General Fund Budget Senior Citizens Center (1560) 2019 to 2017 2018 2019 2020 2020 2021 Account Description Actual Actual Budget Budget % Inc/(Dec)Estimate 4010 Salaries & Wages-Reg 103,215 105,339 121,860 122,900 0.9%126,600 4020 Salaries & Wages-Temp 64,368 73,798 68,000 78,000 14.7%86,000 4021 Overtime-Temp 402 562 1,000 700 (30.0%)800 4030 Contributions-Retirement 20,434 21,321 27,000 27,000 0.0%29,000 4040 Contributions-Insurance 10,720 11,947 28,000 23,400 (16.4%)27,400 4050 Workers Compensation 4,802 5,148 5,000 5,500 10.0%5,500 *Total Personal Services 203,942 218,116 250,860 257,500 2.6%275,300 4120 Supplies-Equipment 2,019 2,352 2,500 2,300 (8.0%)2,300 4130 Supplies-Program 22,063 19,277 18,000 18,000 0.0%18,000 4240 Uniforms & Clothing 2,035 1,982 1,700 2,000 17.6%2,000 *Total Materials & Supplies 26,117 23,611 22,200 22,300 0.5%22,300 4300 Fees, Services 65,606 58,900 66,600 66,600 0.0%66,600 4310 Telephone 2,155 2,418 2,200 2,400 9.1%2,400 4320 Utilities 4,660 7,447 4,600 7,500 63.0%7,500 4340 Printing & Publishing 9,683 7,477 7,500 7,500 0.0%7,500 4370 Travel & Training 507 364 500 500 0.0%500 4380 Mileage - - 100 100 0.0%100 4400 Rental-Land & Buildings 8,303 8,298 7,000 8,200 17.1%8,200 4410 Rental-Equipment 32,412 35,768 32,000 36,000 12.5%36,000 *Total Contractual Services 123,325 120,673 120,500 128,800 6.9%128,800 **Total Recreation Programs 353,384 362,400 393,560 408,600 3.8%426,400 SIGNIFICANT CHANGES DESCRIPTION OF CHANGE 2020 2021 2020 General Fund Budget Recreation Programs (1600) 2019 to 2017 2018 2019 2020 2020 2021 Account Description Actual Actual Budget Budget % Inc/(Dec)Estimate 4010 Salaries & Wages-Reg 25,806 26,335 13,600 13,700 0.7%14,000 4020 Salaries & Wages-Temp 1,950 1,100 2,200 2,200 0.0%2,200 4030 Contributions-Retirement 4,020 3,991 2,100 2,100 0.0%2,300 4040 Contributions-Insurance 2,645 2,951 3,100 2,600 (16.1%)3,000 4050 Workers Compensation 337 271 400 400 0.0%400 *Total Personal Services 34,757 34,647 21,400 21,000 (1.9%)21,900 4130 Supplies-Program 4,283 4,424 4,500 3,300 (26.7%)3,300 *Total Materials & Supplies 4,283 4,424 4,500 3,300 (26.7%)3,300 4300 Fees, Services 11,573 11,929 12,500 12,500 0.0%12,500 *Total Contractual Services 11,573 11,929 12,500 12,500 0.0%12,500 **Total Self-Supporting Programs 50,614 51,000 38,400 36,800 (4.2%)37,700 SIGNIFICANT CHANGES DESCRIPTION OF CHANGE 2020 2021 2020 General Fund Budget Self-Supporting Programs (1700) 2019 to 2017 2018 2019 2020 2020 2021 Account Description Actual Actual Budget Budget % Inc/(Dec)Estimate 4020 Salaries & Wages-Temp 23,393 21,525 26,000 26,000 0.0%27,000 4021 Overtime-Temp - 19 - - 0.0%- 4030 Contributions-Retirement 2,438 2,386 2,800 2,800 0.0%2,800 4050 Workers Compensation 1,481 1,235 1,600 1,600 0.0%1,600 *Total Personal Services 27,311 25,164 30,400 30,400 0.0%31,400 4120 Supplies-Equipment 82 - - 0.0%- 4130 Supplies-Program 2,438 1,573 2,500 2,500 0.0%2,500 4240 Uniforms & Clothing 5,427 4,917 5,400 5,400 0.0%5,400 *Total Materials & Supplies 7,947 6,490 7,900 7,900 0.0%7,900 4375 Promotional Expenses - - 300 300 0.0%300 *Total Contractual Services - - 300 300 0.0%300 **Total Recreation Sports 35,258 31,653 38,600 38,600 0.0%39,600 SIGNIFICANT CHANGES DESCRIPTION OF CHANGE 2020 2021 2020 General Fund Budget Recreation Sports (1800) CITY OF CHANHASSEN 2020 Budget 2019 2020 Dollar Percent OPERATIONAL & CAPITAL LEVY Levy Levy Change Change General Fund $8,810,333 $9,181,833 Capital Replacement Fund (for equipment)800,000 800,000 Revolving Imp Street Reconstruction 381,223 728,523 Pavement Mgmt Fund (Sealcoating)93,000 93,000 Total Operational & Capital Levy 10,084,556 10,803,356 718,800 7.13% DEBT LEVY Public Works Facility 475,800 480,600 Library Referendum 459,512 457,412 Total Debt Levy 935,312 938,012 2,700 0.29% TOTAL TAX LEVY $11,019,868 $11,741,368 $721,500 6.55% Scenario #1 Scenario #2 Scenario #3 Levy Levy Levy Taxes applied to:General Fund $9,181,833 $9,181,833 $9,181,833 Capital Replacement 800,000 800,000 800,000 Pavement Mgmt 93,000 93,000 93,000 Revolving Imp St Recon 728,523 728,523 728,523 Total Levy subject to levy limits $10,803,356 $10,803,356 $10,803,356 Public Works Facility $480,600 $480,600 $480,600 Library Referendum 457,412 457,412 457,412 Total $11,741,368 $11,741,368 $11,741,368 Tax Generation Capacity (Not actual levy, Used only for estimating the impact on the average home) Prior Year $11,019,868 $11,019,868 $11,019,868 New Construction (0.97%)$177,100 $177,100 $177,100 Total Capacity $11,196,968 $11,196,968 $11,196,968 Percent Change (To avg home city prop tax) after New Growth 4.86%4.86%4.86% Staff recommendation for final Levy TAX LEVY "F)³C H ±"F) LakeMinnewashta Lake Lucy LakeAnn Lotus Lake Lake Susan LakeRiley LakeHarrison Rice MarshLake Rice Lake LakeSaintJoe LakeVirginia LakeMinnewashtaRegional Park(County Park) HermanField Park RoundhousePark MinnewashtaHeights Park PheasantHillPark NorthLotusLakePark CarverBeachPark MinnesotaLandscapeArboretum Minnesota Landscape Arboretum ChanhassenNaturePreserve Bluff CreekPreserve BluffCreekPreserve BluffCreekPreserve PioneerPassPark Bluff Creek Golf Course Hesse FarmPreserve Seminary FenScientific and Natural Area(SNA) Raquet WildlifeManagement Area(WMA) Raquet WildlifeManagement Area(WMA) MN Valley NationalWildlife Refuge FoxwoodsPreserve RileyRidgePark BandimerePark LakeSusanPark LakeSusanPreserve LakeAnnPark MeadowGreenPark SouthLotusLakePark PowerHillPark PleasantViewPreserve M innesota RiverCathcartPark K eber P ondChristmasLake BrendanPond ?©A@?©A@?©A@ ?©A@ +¢ +¢ +¢ ?ûA@ ?ûA@ ?«A@ ?«A@ ?ÌA@ ?ÌA@ ?ÌA@ ?ûA@ ?ûA@ GoWX GrWX GrWX GrWX GïWX GqWX GqWX GqWX GqWX GqWX GnWX GnWX GnWX GÇWX GÇWX GÇWX GïWXSunsetTrl LakeDrE PondP ro m e nade Hawthorne Cir GreatPlainsBlvdRedCedarPt Rd W 78th St L y ma n B lv d Lyman Blvd Corporate Pl 62nd St W Wa s hi ngt onBlvdW79thStPowersBlvdH ig h w ay 7Highwa y 7 Audubon RdChaskaRdW 192nd AveArboretum Blvd A r b o re tu m Blvd Arboretum BlvdChaska BlvdLaredoDrW 96th St H eartla nd CtHazeltine BlvdOakside Cir M a r k e t S t Lake Dr Lake Dr W M a inStP ark RdPioneerTrl BluffCreekDr KerberBlvdW78thS tPontiac Ln Carver Beach Rd H i g h w a y 2 1 2 PheasantDr Highway 212B l u e S a g e L n W W 77th StHighwoodDr W 78th St Pleasant View Rd Charing BendCree Dr F ly in g C lo u d D rRiley Rdg Ponderosa DrHazeltineBlvd Rojina LnCa m den R d g DrBentz DrLakeway CtRosew o odDrHesse Farm Cir Topaz Dr Minnewashta Ct W 94th St Harvest Way SantaV e ra D r C o a c h DrMurray Hill RdMill CreekLnLakeLucyRdBluff Rdg CtM erg ans e r C tPi edm o nt Ct C he y e n n e Sp u r HenryCtTe rn C t White Dove Cir Santa Fe Trl Coach CtStag Horn Ln Delphinium LnGunflint Ct S o u th e r n C tL in d e n Cir A utum n R dg C tRiley C urve D ia mo n d C t Erie SpurSh a d o wme r e L a k e w a y L n OverlookCtMission Hills Ct Im per ial D r SierraCt Chippewa CirArlington CtMoline CirValley Rdg CtVogelsberg TrlOrioleAve Cascade Ct Parkland WayCrocus CtTulip CtMiranda WayM illsDr Deerfoot Trl Forest Ave Edgewood Ct W a t e r le a f L n WCentury CtW 86th St Murray Hill Ct Basswood Cir Sp rin gfiel d DrPaddockLn Kingfisher Ct E ss e x RdThrush CtWindmill DrWel sl ey Ct Ce n tu r y Trl C reekview Ct Koehnen Cir E Primrose PlPioneer CirGreenleafCtCentury PlFoxtail Ct Longac r e s Dr PreaknessLn Commerce DrVillage Cir Poppy Dr S h a s ta C ir W LaredoLnB i g h o r n DrDakota LnA ld er Way Malla rd CtHighcrest CirMoccasinTrl Villa g e S t Olympic Cir San d y H o o k R d Crestview DrFrontier CtTrappers P a s s BluffViewCt Picha Dr Coulter Blvd Chaparral CtIthilie n Hallgren Ct Stone Cr eek Ct F o x C tQuiver Dr Napa DrWoodDuckCir SierraTrlSettlersCtHighoverCtSBarbara Ct R e dwi ngLnStoneCreekDrRed Fox Cir Gray Fox LnForestCirRed Cedar CoveValley View Ct Sa d dlebrookC u rve Dove CtStratford Ln Roosevelt DrStratford RdgShenendoah Sinnen Cir Highland Dr Hic kory Rd Shore Dr EgretCtPelican CtJefferson DrVassermanTrl Madison DrBenwoodCirKiowaCi r NezPerceCt SwanCtBurlwood DrL a k e HarrisonCir Dakota Cir Pipewood Cir W Village Rd 77th St W A s h to n C tBlue Jay CirJuniper AveMelodyHill Cr e e k Run Trl Horseshoe LnMonk CtS Cedar D rPipew o o d Ct M e lod y LnNorthwoodCtRidgeview Pt W illo w C reekOrchard L n Western Dr PenamintLnLodgepolePtW 76th St Acorn LnAlisa LnPleasantParkDrC o neflowerCurveSBuckingwoodC tCentury Cir Oakwood Rdg Cre ekwood Dr Great Plains BlvdBlackbird CtS addlebroo k Trl Trapline CirGr e enbri a r AveWashtaBayCt W77th St Treetop RdCanterburyCir Fa w n H i l l C t Chan ViewForestRdgCir Greenview D r Jeurissen LnChesterfieldLn Fox DrLone Eagle Dr RidgeviewW a y C r e s tv i e w Cir Audubon CirBrinker St R en a i ss an c e CtArrowheadLn Peaceful LnBittern Ct Heather CtBriarwoodCtM allory C tLandings Ct Lilac Ln PembrokePass MaryJaneCirTanagersPtIb i s CtHeron Dr Quail CrossingRedman LnPark Ct M aplewood TerC a s c a d e C i r Valley Rdg Pl Na v a j o D rWhiteDove Dr Steller Ct RaspberryHill63rd St W MissionHillsCirBrett onWayM a r i g o l d C tM aplew ood C irQuinn RdApple Tree Ln H a rr i sonHillTrl Highway5 Park DrEmeraldLn ValleyViewPlB eaconCtCrossroadsBlvdStoneCreekRdTwinMapleLn D a rt m o u th Dr Pine w o o d Cir Highover Way Vineland CtPleasantViewCo v e Pineview Ct W h i t e t a i l R d g C tTroendle CirKoehnen Cir Chest nu tLn Hidden LnDel Rio Dr Pleasant A ve Andrew Ct LymanCt F ly in g C lo u d D r CheyenneTrl Vasser manPl Arboretum Dr Wiltsey Ln Maple S hore s Dr Pim lico LnArbor LnDeerwoodDrIronwoodRd HillStPenamintCt WynsongLn Co n estogaTrlT raplineLn Stratton Ct CimarronCir TimberHillRd Upla n d C ir BellevueCtBruleCirLakePt Sommergate MohawkDrRingo Dr HunterDr Summit Cir GoldenCt82nd St EPipewoodLn W 65th St FlintlockTrl187thAveWMcglynn Dr Eri eAveCounty Rd 101 BaneberryWayW SapphireLnLukewoodDr Red Oak Ln HighoverLnEastwoodCtCypressDrMarshlandTrlLongviewCir Hallgren Ln AlisaCtShadowLnHuronHiawatha Dr W Farm R d KiowaF o x H ill D r Pa r kPl Big W oodsBlvd M a y a p plePa s s PointeLakeLucyWoodhill Dr Mou n ta in W aySunridg e Ct Butte Ct Ma j esti c Way G alpinCt Crestview Dr FirTreeAveHummingbird RdShawneeLnWaterTower Pl N ManorR d QuattroD r He i d i LnChesMarFarmRd MotorplexCtTanadoona Dr LakeHarriso n Rd 78th St W Mea d o wlarkLnL a k o t a LnRdg RdWestwoodDrW 8 2 n d S t Hesse Farm Rd GreatPlainsBlvdN ez Perce DrMis s ionHillsDrMarketBlvd Bluff Creek BlvdC om m onwealthBlvd RiverRockDrNBluebonne t B lv dCenturyBlvdAudubon RdKiowa TrlLakeSusanHills DrGalpinBlvd StoughtonAveNi chol a sWayDell RdWashta BayRd Autumn Rdg AveH o lly L n ChanhassenRdLakeRileyDrChoctaw Cir S a n d p ip erTrlKi ngs Rd Kurv er sPtRdDogwoodAveRubyLn Suffolk DrMinnewashtaParkwayDako t a Ave Lake Susan DrMapleRdArboretum Village PlGalpin BlvdYosemite AveNear M o u ntain Blvd Leslee Curve ChippewaTrlLakewayDrDeglerCirManchesterDrPinehurstDr M ulberryCir R ockyIslan dLn SouthwestVillage Loop Ma r s h Dr River Ro c k D r SMeadowLn C astl e RdgLakeviewRdE Hopi Rd Frontier TrlFawnHillRd Erie AveMission HillsLnFox Hollow CtUtica LnOs preyLnFlamingoDr TecumsehLnSarato gaDr Powers BlvdPowers BlvdG u n flintTrlLoneCedar LnTetonLnLucyRdgLn O x bowBendChanhassen H il l sDrNDerbyDrHighoverDrF oxPathBluebill T r lUtica CirPleasant View CirCountry Oaks Dr Hemlo c k Way Timberwood Dr Cheyenne AvePleasant View WayHidden CtW alnut Cu rv e Pi m a L nTrailsEndRdRi ngne c k Dr Kel ly C t GrayF o xCurveCactus C u rveTanagersLnMelody Hill Cir Autumn Rdg LnHorseshoeCurve Lakerid g e R d W Lake DrSu n n y v a le DrChurch RdHighover Ct NFoxfordRd Valley Rdg Trl N ErieCir PowersPlBentBowTrlCascade Pass KnobHillLn DakotaA v e ReflectionsR d H ess e F ar m Cir Pont i a c Cir H illsdale C t Pawnee DrHeidiLnC h a p a rr al LnGlendale Dr W Farm Rd BluffC ir Uti caT er L a n d in g sDrTrotters Cir Mandan CirIroquois64th St WArboretum Bl vdDogwoodRdLak e Ri leyTrl LoneCedarCir PiperR d g L n CastleRd g CtTig u a L nCartway LnBethes daCirWaters Edge DrGr andview RdDrakeCtBr e n d e n Ct Ches Mar DrLakeRileyBlvdHomestead LnMin n e wa shta WoodsDrDeerfoot Trl LotusTrl Kimberly Ln I ndianHillRd N BayDrMulberryCirESandyHookCir Preserve Ct LakeLucy Ln StonefieldLnElmTreeAveSummerfie ld Dr C h a nha ssenHillsDrSD ee rb ro o k D rBr idle Creek TrlBoulderR d M ainStLakeAnnParkDr ³C H ±City Hall "F)Fire Station Pothole Patching Railroad Rivers Lakes Parks Parcel Boundaries C i t y o f C h a n h a s s e n 2020 Pothole Patching Contract Areas µ0 4,000Feet 0 0.5MileDate Created: 10/30/2019Document Path: K:\WSB\Maps\PublicWorks\PotholePatchingMap2020_11x17.mxd Created By: City of Chanhassen - Engineering Department 2005 2006 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 2017 2018 2019 2020 2021 New Growth Per Carver County 2.00%2.50%2.90%1.82%2.45%1.39%1.06%1.16%1.82%1.77%1.76%1.85%1.56%1.10%0.97%1.61% Preliminary Levy Change as a %9.53%-0.90%2.36%2.92%3.00%1.38%1.06%-0.30%1.82%1.77%1.76%1.85%1.56%1.10%0.97%6.54% Levy Current Year 9,439,754 9,354,890 9,575,778 9,834,965 10,074,565 10,213,190 10,267,390 10,153,690 10,195,890 10,334,140 10,484,021 10,629,621 10,795,121 10,913,868 11,019,868 11,741,368 Levy Prior Year 8,639,167 9,439,754 9,354,890 9,575,778 9,834,965 10,074,565 10,213,190 10,267,390 10,153,690 10,195,890 10,334,140 10,484,021 10,629,621 10,795,121 10,913,868 11,019,868 Dollar Change in Levy 800,587 (84,864) 220,888 259,187 239,600 138,625 54,200 (113,700) 42,200 138,250 149,881 145,600 165,500 118,747 106,000 721,500 Percentage Change in Levy 9.27%-0.90%2.36%2.71%2.44%1.38%0.53%-1.11%0.42%1.36%1.45%1.39%1.56%1.10%0.97%6.54% Tax Rate 28.118 26.638 23.788 23.713 22.993 25.183 26.603 28.532 28.428 27.238 24.633 24.252 23.854 22.666 21.1045 21.132 City of Chanhassen New Growth VS Levy Change And Compared to Tax Rate 2020 Budget Assumptions •$177,100 (1.61%) increase in levy dollars due to new construction •A 16% reduction in healthcare costs •Building permit revenue budgeted same as 2019 •A 3% increase for cost of living and merit pay •A 5% increase in the police services contract •The average home in Chanhassen increased in taxable market value by 5% 2020 Scenario #1 •LEVY –Scenario #1 would be a total levy of $11,231,368, an increase of $211,500 (1.92%), $34,400 above 2019 new growth. •POTENTIAL BUDGET IMPACT –This scenario is an increase in service levels for the expanded duty crew. It would also leave the entire Library Levy intact to allow more flexibility in future years. •RESIDENT IMPACT –The result of this levy would be between a $3-$4 increase in the property tax bill (city portion) on the average home. 2020 Scenario #2 •LEVY –Scenario #2 would be a total levy of $11,196,968, an increase of $177,100 (1.61%), the amount of new growth in 2019. •POTENTIAL BUDGET IMPACT –This scenario does result in increased service levels for the expanded duty crew. Staff would recommend the use of $34,400 of the Library Levy to achieve this total levy goal. •RESIDENT IMPACT –The result of this levy would be no increase in the property tax bill (city portion) on the average home. 2020 Scenario #3 •LEVY –Scenario #3 could include funding for future needs. •POTENTIAL BUDGET IMPACT -This scenario would include increased service levels for the expanded duty crew. It also could include additional known funding needs for future years as follows: -Fund additional park maintenance employee ($80,000) -Fund additional street maintenance employee ($80,000) -Fund half time fire dept admin position at FT ($37,000) -Fund a portion of Pavement Management Levy of 2021 ($350,000) -Fund permanent rev stream for Park Eqpt Replace Levy by 2022($250,000) •RESIDENT IMPACT –The result of this levy would be an increase to the city portion of the property tax bill on the average home by about $10 for every $100,000 of additional levy. 2020 Gen Fund Budgeted Expenditures % Increase City Population 2018 2019 From 2018 Chanhassen 25,955 11,414,000 11,618,060 1.8% Chaska 26,941 16,511,385 16,896,838 2.3% Cottage Grove 36,399 20,160,615 20,958,986 4.0% Elk River 24,567 16,072,250 17,096,650 6.4% Inver Grove Heights 35,106 24,925,500 27,189,400 9.1% Lino Lakes 21,117 9,675,086 9,984,864 3.2% Prior Lake 25,735 12,651,813 13,336,972 5.4% Rosemount 23,965 13,566,000 14,261,600 5.1% Savage 30,713 14,948,819 15,951,876 6.7% Shakopee 41,519 26,928,100 27,558,500 2.3% Stillwater 19,748 14,996,044 15,995,345 6.7% Average 28,342 16,537,783 17,349,917 4.8% KFS General Fund Budgeted Expenditure Comparison 2020 Per Capita City Spending 2019 Chanhassen 447 Chaska 627 Cottage Grove 576 Elk River 696 Inver Grove Heights 774 Lino Lakes 473 Prior Lake 518 Rosemount 595 Savage 519 Shakopee 664 Stillwater 810 Average 609 KFS General Fund Per Capita Spending Comparison 202 0 City 2019 Tax Rate** Chanhassen 21.104 Chaska 27.678 Victoria 31.271 Mayer 49.252 Carver 50.592 Waconia 52.500 Watertown 56.473 Cologne 62.415 Norwood Young America 70.399 New Germany 97.651 Hamburg 122.130 Average 58.315 ** Based on Urban Tax Rates Carver County Tax Rates 2020 Hennepin County Tax Rates -2019 2020 City Tax Rate**City Tax Rate** Chanhassen 21.104 Mound 43.107 Medina 21.529 St. Louis Park 46.373 Wayzata 21.672 Crystal 48.771 Minnetrista 24.915 Robbinsdale 50.807 Plymouth 26.355 Rockford 50.931 Excelsior 27.124 Brooklyn Park 52.695 Edina 27.499 Golden Valley 53.780 Shorewood 28.539 Richfield 54.737 Eden Prairie 31.690 Minneapolis 57.312 Maple Grove 34.899 Osseo 60.009 Minnetonka 34.960 New Hope 67.990 Rogers 35.917 Hopkins 71.697 Champlin 39.611 Brooklyn Center 71.860 Bloomington 41.581 AVERAGE 42.499 ** Based on Urban Tax Rates Recommendation Staff recommends setting a preliminary levy using at least Scenario #1 ($11,231,368, or $34,400 above new growth) to allow for flexibility and planning before setting a final levy in December. 202 0 2020 Thank You! CARVER COUNTY LEVY COMPARISONS FINAL PROPOSED TOTAL LEVY TOWNSHIPS 2019 Levy 2020 Levy % CHANGE Benton 225,000$ 255,000$ 13.333% Camden Proper 240,000$ 240,000$ 0.000% New Germany Fire 36,000$ 36,000$ 0.000% NYA Fire 19,000$ 21,000$ 10.526% Mayer Fire 18,000$ 18,000$ 0.000% Plato Fire 2,000$ 3,000$ 50.000% Dahlgren 300,000$ 350,000$ 16.667% Hancock 100,000$ 100,000$ 0.000% Hollywood 320,000$ 330,000$ 3.125% Laketown 510,000$ 510,000$ 0.000% San Francisco Proper 220,800$ 238,900$ 8.197% Carver Fire 62,000$ 62,000$ 0.000% Belle Plaine Fire 21,000$ 26,000$ 23.810% Waconia 272,000$ 317,000$ 16.544% Watertown 373,000$ 373,000$ 0.000% Young America Proper 200,000$ 200,000$ 0.000% NYA Fire 35,000$ 40,000$ 14.286% Plato Fire 2,000$ 3,000$ 50.000% Hamburg Fire 30,000$ 30,000$ 0.000% TOWNSHIP TOTAL 2,985,800$ 3,152,900$ 5.596% FINAL PROPOSED TOTAL LEVY CITIES 2019 Levy 2020 Levy % CHANGE Carver 2,713,263$ 3,053,041$ 12.523% Chanhassen 10,560,356$ 11,283,956$ 6.852% Chanhassen EMV 459,512$ 457,412$ -0.457% Chaska 9,201,811$ 10,350,385$ 12.482% Cologne 1,304,146$ 1,457,725$ 11.776% Hamburg 501,530$ 551,683$ 10.000% Mayer 1,117,624$ 1,285,454$ 15.017% New Germany 421,421$ 425,741$ 1.025% Norwood Young America 2,579,910$ 2,914,027$ 12.951% Norwood Debt-EMV based 22,260$ 21,630$ -2.830% Victoria 5,027,000$ 5,708,000$ 13.547% Waconia 8,398,680$ 8,615,964$ 2.587% Watertown 2,444,910$ 2,560,000$ 4.707% CITY TOTAL 44,752,423$ 48,685,018$ 8.787% FINAL PROPOSED TOTAL LEVY SCHOOLS 2019 Levy 2020 Levy % CHANGE School 108 - TC Based $ 1,729,444 $ 1,869,921 8.123% - EMV Based $ 831,481 $ 540,654 -34.977% School 110 - TC Based $ 10,055,817 $ 10,570,060 5.114% - EMV Based $ 5,498,453 $ 5,763,771 4.825% School 111 - TC Based $ 5,532,438 $ 5,617,713 1.541% - EMV Based $ 1,445,662 $ 1,409,794 -2.481% School 112 - TC Based $ 29,829,598 $ 27,745,364 -6.987% - EMV Based $ 19,317,134 $ 18,361,834 -4.945% SCHOOL TOTAL 74,240,027$ 71,879,111$ -3.180% FINAL PROPOSED TOTAL LEVY COUNTY 2019 Levy 2020 Levy % CHANGE County 56,264,855$ 59,073,855$ 4.992% Carver County CDA 2,503,130$ 2,679,432$ 7.043% Carver County Rail Authority 162,000$ 170,084$ 4.990% COUNTY TOTAL 58,929,985$ 61,923,371$ 5.080% FINAL PROPOSED TOTAL LEVY 2019 Levy 2020 Levy % CHANGE Carver County WMO 764,979$ 802,802$ 4.944% COUNTY WS DISTRICT TOTAL 764,979$ 802,802$ 4.944% FINAL PROPOSED TOTAL LEVY MISC DISTRICTS 2019 Levy 2020 Levy % CHANGE Met Council 1,024,015$ 995,820$ -2.753% Met Transit District 1,190,365$ 1,243,870$ 4.495% Mosquito Control 653,288$ 664,487$ 1.714% Chaska City EDA 498,843$ 165,747$ -66.774% NYA City EDA 51,272$ 55,916$ 9.058% Victoria EDA 188,000$ 188,000$ 0.000% Watertown EDA 55,294$ 58,575$ 5.934% Lower MN WS #1 48,443$ 47,264$ -2.434% Riley Purg WS #2 838,911$ 864,204$ 3.015% Minnehaha Crk WS #3 436,687$ 423,983$ -2.909% Buffalo Crk WS #4 1,975$ 2,580$ 30.633% MISC DISTRICT TOTAL 4,987,093$ 4,710,446$ -5.547% GRAND TOTAL 186,660,307$ 191,153,648$ 2.407% NOTE: COUNTY WATERSHED DISTRICT Levies have been reduced by Local Government Aid. Prepared by Carver County Taxpayer Services Dept. S:\Tax Clerks\Tax\Tax Rate Sheets\Levy\F2019P2020 Revised 10/15/2019 CARVER COUNTY RATE COMPARISON Final Final Proposed 2019/2020 TOWNSHIPS Pay 2018 Pay 2019 Pay 2020 % Change Benton 13.19062950 12.80922124 14.13432251 10.34% Camden Proper 14.09007602 13.58017499 13.29150582 -2.13% NYA Fire Dist 3.23643541 3.50626049 3.73454099 6.51% New Germany Fire Dist 4.88826382 4.67714588 4.64188814 -0.75% Mayer Fire Dist 4.79654826 4.89616509 4.77540628 -2.47% Plato Fire Dist 2.29349600 2.27066088 3.30197844 45.42% Dahlgren 10.95649334 10.47491468 11.97008286 14.27% Hancock 14.24848462 13.80213298 13.12556288 -4.90% Hollywood 17.57521942 16.97828109 16.90877370 -0.41% Laketown 15.54583813 14.68423471 14.09810828 -3.99% San Francisco Proper 15.86760652 13.10844586 13.51718564 3.12% Carver fire/amb 5.37446328 5.76585554 5.51468249 -4.36% Belle Plaine fire/amb 3.44690741 3.44760774 4.04287995 17.27% Waconia 11.54519477 10.70526414 11.71985023 9.48% Watertown 14.75432022 14.16004784 13.81046706 -2.47% Young America Proper 12.32420596 12.14596780 11.98029458 -1.36% NYA Fire Dist 3.98800937 3.93012598 4.37616950 11.35% Hamburg Fire Dist 4.69397682 4.61149496 4.61443215 0.06% Plato Fire Dist 2.82814887 1.89515972 2.85063601 50.42% Final Final Proposed 2019/2020 CITIES Pay 2018 Pay 2019 Pay 2020 % Change Carver 47.70286754 50.59165406 49.59052208 -1.98% Chanhassen Rural 17.25454329 16.06607301 16.07457352 0.05% Urban 22.66614244 21.10455967 21.13281570 0.13% RMV Based 0.01113466 0.01026695 0.00955511 -6.93% Chaska Annex 27.23423503 0.00000000 0.00000000 0.00% Rural 24.51081153 27.67761339 0.00000000 -100.00% Urban 27.23423503 27.67761339 28.40458442 2.63% Cologne 67.95190441 62.41482085 64.30493322 3.03% Hamburg 103.20053000 122.13038650 117.00217229 -4.20% Mayer Rural 26.75858867 23.83866136 25.12817461 5.41% Urban 50.61197991 49.25198432 51.99226620 5.56% New Germany Rural 33.65368380 32.16406378 31.43764169 -2.26% Urban 98.75023906 97.65142070 96.40421187 -1.28% Norwood Young America 71.83644297 70.39920067 73.65564455 4.63% Norwood Debt-RMV based 0.01568245 0.01850757 0.01707764 -7.73% Victoria Rural 16.08829661 16.02274220 15.32952002 -4.33% Urban 31.49540889 31.27120069 30.97567073 -0.95% Waconia 52.83585366 52.50018253 47.20670438 -10.08% Watertown Rural 38.57437010 35.78244427 34.75025213 -2.88% Urban 59.54859733 56.47273912 55.09721590 -2.44% Final Final Proposed 2019/2020 SCHOOL DISTRICTS Pay 2018 Pay 2019 Pay 2020 % Change #108 17.96146138 15.01416985 15.66881706 4.36% RMV Based 0.11074651 0.09156511 0.05171436 -43.52% #110 33.49291051 33.80027190 32.21841799 -4.68% RMV Based 0.11856463 0.20594870 0.18830801 -8.57% #111 44.08530846 38.81329961 37.37334644 -3.71% RMV Based 0.12422166 0.11995872 0.10843251 -9.61% #112 33.83738096 33.63114539 28.06357931 -16.55% RMV Based 0.23096398 0.22511890 0.19329216 -14.14% #276 23.13300000 21.20900000 21.15000000 -0.28% RMV Based 0.30308000 0.34013000 0.33908000 -0.31% #424 10.65000000 13.81300000 13.86300000 0.36% RMV Based 0.24522000 0.23459000 0.24464000 4.28% #716 36.36239564 32.27401197 29.66245106 -8.09% RMV Based 0.11777622 0.08434441 0.09935722 17.80% #2687 39.51600000 36.74700000 35.79500000 -2.59% RMV Based 0.11598000 0.13512000 0.14079000 4.20% #2859 16.65700000 16.99200000 16.85100000 -0.83% RMV Based 0.14715000 0.12760000 0.11406000 -10.61% Prepared by Taxpayer Services Dept. S:\Tax Clerks\Tax\Tax Rate Sheets\Rates\F18F19P20 Revised 10/15/2019 CARVER COUNTY RATE COMPARISON Final Final Proposed 2019/2020 COUNTY RATES Pay 2018 Pay 2019 Pay 2020 % Change Carver County 37.43567297 36.48828974 35.12045009 -3.75% Carver County CDA 1.63992538 1.62567858 1.59569345 -1.84% Carver County Rail Authority 0.11416645 0.10446082 0.10117291 -3.15% Final Final Proposed 2019/2020 MISC DISTRICTS Pay 2018 Pay 2019 Pay 2020 % Change Met Council 0.82675038 0.65043052 0.58872049 -9.49% Met Transit District- Chanhassen & Chaska 1.36626507 1.45375652 1.39403057 -4.11% Mosquito Control 0.44605329 0.42258864 0.39390678 -6.79% Chaska City EDA 1.50336664 1.49660027 0.31305763 -79.08% Norwood Young America EDA 1.41334216 1.40350751 1.39871707 -0.34% Victoria EDA 1.25537481 1.15816447 1.00653845 -13.09% Watertown EDA 1.35019612 1.27435498 1.26319716 -0.88% WS#1 Lower MN (060)0.59357537 0.66825973 0.57831426 -13.46% WS#2 Riley Purg (064)2.25782667 2.21580141 2.11857234 -4.39% WS#3 Minnehaha (062)1.69342570 1.65195622 1.44752143 -12.38% WS#4 Buffalo Creek (005)1.93376827 1.21310847 1.59020369 31.09% Final Final Proposed 2019/2020 Pay 2018 Pay 2019 Pay 2020 % Change Carver County WMO (067)0.96669315 0.92696656 0.89126406 -3.85% Fiscal Disparity Rate 145.095 143.992 142.454 -1.07% Ag. Preserve Rate 82.000 84.000 85.000 1.19% State General Tax Rate (Commercial)43.865 42.416 39.000 -8.05% State General Tax Rate (Seasonal Rec)20.779 19.962 19.000 -4.82% All rates are Tax Capacity based unless otherwise noted and are shown before reduction of DRA (Disparity Reduction Aid), if applicable. Credit Calculations: $75,000 $30,000 Carver County Watersheds: (Applicable to regular tax capacity of Commercial, Industrial, Pub Utilities, Railroads, Personal Property, & *Seasonal Rec classifications) (*Non-commercial Seasonal Rec - .40% of 1st $76,000 value used to determine tax capacity for State General Tax.) Residential Homestead Market Value Exclusion Residential Homestead Market Value Exclusion reduces the estimated market value of a property for tax calculation. Residential Homestead Taxable MV Exclusion (applicable to Res Homestead property & House-Garage-1 Ac of Res Ag & Comm Seasonal Rec Res property) 40% of 1st $76,000 of Estimated Market Value Reduction to exclusion: 9% of Estimated Market Value over $76,000 Residential Homestead Market Value Exclusion Examples Total Estimated Market Value Homestead Market Value Exclusion $50,000 $20,000 $76,000 $30,400 $100,000 $28,200 $200,000 $19,200 AG Homestead Taxable MV Credit (Applies to Ag Homestead property & excludes House-Garage-1 Acre value) $300,000 $10,200 $350,000 $5,700 $400,000 $1,200 $413,800 $0 $450,000 $0 Agricultural Homestead Market Value Credit Ag Homestead Market Value Credit Examples .30% of Taxable Market Value up to $115,000 .10% of Taxable Market Vaule over $115,000 (Maximum of $490) Total Taxable Market Value Credit Amount $50,000 $150 $75,000 $225 $100,000 $300 $115,000 $345 $600,000 $490 Ag Homestead MV Credits reduce only TC based taxes. Credits in excess of TC based taxes cannot be used to reduce Referenda Market Value based taxes or state tax. $150,000 $380 $200,000 $430 $345,000 $490 Prepared by Taxpayer Services Dept. S:\Tax Clerks\Tax\Tax Rate Sheets\Rates\F18F19P20 Revised 10/15/2019 CITY COUNCIL STAFF REPORT Tuesday, November 12, 2019 Subject Key Financial Strategy: Discussion of Utility Fund Fees Section 5:00 P.M. WORK SESSION Item No: A.4. Prepared By Greg Sticha, Finance Director File No: BACKGROUND On September 23rd the city council reviewed all of the city’s utility connection fees with Ehlers & Associates. Part of that process included researching if there was some way to have a lessor impact on new local businesses in total cost of SAC/City connection fees. Staff presented some policy changes to the rate setting practices used to allocate the system infrastructure costs to both the current users and incoming users for city council’s consideration. The practices used to date are in large part due to the allocation of debt related to the water treatment plants, which was based on current population and eventual final buildout population in the city’s future. This allocation was one of the items discussed as a possible policy change. The impact of that policy change would be a shifting of costs from future users to current users and would result in lower connection fees and higher usage rates. Also, staff presented a couple of other potential policy changes surrounding time of collection of fees and the lowering of the fee rate charged to multi family uses. Staff is not recommending any changes in policy but presented these options for possible consideration by the city council. There was some discussion by the city council about not making any significant policy changes but rather make exceptions to fees paid for certain user types or businesses. Staff would not recommend an exceptionbased policy as it will create a number of equality and fairness issues that will present a number of significant challenges to the city as it builds out the rest of its utility system. Listed below are some of those challenges: Equity Issues among New Businesses requesting Subsidy: Picking and selecting which new incoming businesses that would be eligible for a reduced fee would provide a number of challenges including administrative costs and possible legal disputes. Equity Issue between New Businesses and Existing Businesses: The current businesses that have recently paid the fees, some of whom had requested reduced fees, would most likely find issue with a change in policy shifting costs to existing taxpayers or rate payers. Could be considered a business subsidy under state law: The waived fees could be considered a “business subsidy” under state law and would therefore require a business subsidy agreement. A business subsidy agreement would entail added administrative costs to: demonstrate public purpose; facilitate public hearing and annual state reporting requirements; and entering into a contract with the recipient to maintain operations for at least five years, meet measurable City criteria for job and wage thresholds, and include recourse if the criteria are not met. No ability to recover deferred fee revenue if a recipient business closes. CITY COUNCIL STAFF REPORTTuesday, November 12, 2019SubjectKey Financial Strategy: Discussion of Utility Fund FeesSection5:00 P.M. WORK SESSION Item No: A.4.Prepared By Greg Sticha, Finance Director File No: BACKGROUNDOn September 23rd the city council reviewed all of the city’s utility connection fees with Ehlers & Associates. Part ofthat process included researching if there was some way to have a lessor impact on new local businesses in total costof SAC/City connection fees. Staff presented some policy changes to the rate setting practices used to allocate thesystem infrastructure costs to both the current users and incoming users for city council’s consideration. The practicesused to date are in large part due to the allocation of debt related to the water treatment plants, which was based oncurrent population and eventual final buildout population in the city’s future. This allocation was one of the itemsdiscussed as a possible policy change. The impact of that policy change would be a shifting of costs from future usersto current users and would result in lower connection fees and higher usage rates. Also, staff presented a couple ofother potential policy changes surrounding time of collection of fees and the lowering of the fee rate charged to multifamily uses. Staff is not recommending any changes in policy but presented these options for possible consideration bythe city council. There was some discussion by the city council about not making any significant policy changes but rather makeexceptions to fees paid for certain user types or businesses. Staff would not recommend an exceptionbased policy asit will create a number of equality and fairness issues that will present a number of significant challenges to the city as itbuilds out the rest of its utility system. Listed below are some of those challenges: Equity Issues among New Businesses requesting Subsidy: Picking and selecting which new incoming businessesthat would be eligible for a reduced fee would provide a number of challenges including administrative costs andpossible legal disputes. Equity Issue between New Businesses and Existing Businesses: The current businesses that have recently paidthe fees, some of whom had requested reduced fees, would most likely find issue with a change in policy shiftingcosts to existing taxpayers or rate payers. Could be considered a business subsidy under state law: The waived fees could be considered a “businesssubsidy” under state law and would therefore require a business subsidy agreement. A business subsidyagreement would entail added administrative costs to: demonstrate public purpose; facilitate public hearing andannual state reporting requirements; and entering into a contract with the recipient to maintain operations for atleast five years, meet measurable City criteria for job and wage thresholds, and include recourse if the criteriaare not met. No ability to recover deferred fee revenue if a recipient business closes. If the property is leased, regardless of user the property owner may benefit from the waived fee more than the business itself does. Any lost connection fee revenue would have to be made up by rate payers. Staff does not recommend an exceptionbased practice or policy for charging the SAC/City connection fees. Staff encourages the continued use of financing the connection fees through an assessment practice. While this practice presents some challenges of its own if the new business does not own the property (all assessed fees are responsibility of property owner), it does give an option for financing the fees without creating equity issues and lost revenues to the city’s utility funds. We have included the rate study presentation from September 23rd for review. DISCUSSION If the city council wants to proceed with an exceptionbased policy it would take significant time and consultation to create a very clear and sound policy and would have to be researched in the upcoming year. If an exceptionbased policy was created it would still carry with it the equality and lost revenue issues that would need to be addressed. For those reasons staff would recommend the setting of the utility rates on December 9th based on the attached utility rate study presentation of September 23rd. ATTACHMENTS: PowerPoint Presentation City of Chanhassen Utility Rate Study and Development Fees Rate Setting Policies Rate Study Results Overview of Water, Sewer, and Storm Utilities Development Fee Comparisons Development Fee Options and Impacts Agenda 9/18/2019 2 Growth pays for growth through hook-up fees Allocate 50% of capital costs for water treatment plant to growth Maintain adequate reserves (50% of operating expenses less depreciation plus 10% of accumulated depreciation) Prudent use of debt Change in policies will impact rates Rate Setting Policies 9/18/2019 3 Summary of Rate Study Results 9/18/2019 4 Projected Usage Rate Increases 2018 Study 2019 Study Water 5.00%5.00% Sewer 5.00%5.00% Storm Water 4.00%5.00% Projected Hook-Up Fee Increases 2018 Study 2019 Study Water 3.50%3.50% Sewer 0.00%0.00% Storm Water 2.00%2.00% Water Utility 9/18/2019 5 Rate increases maintained at 5% by financing a larger portion of future capital projects and delaying projects. Total CIP (2019-2028)2018 Study 2019 Study % Change Capital (Inflated) Capital (Inflated) Water $21,574,814 $26,541,571 23% Projected Usage Rate Increases 2018 Study 2019 Study Water 5.00%5.00% Water CIP 9/18/2019 6 Project Year Amount Average Debt Service Annually $1,800,000 Watermain Replacement Annually $550,000 Street Improvement Program Annually $700,000 TH101 Imp-Pioneer Tr to Flying Cloud Dr 2020-2021 $1,000,000 Low Zone 1M Gal. Elevated Storage Tank 2024 $2,600,000 New Wells 2024 and 2029 $2,600,000 Lower Bluff Creek Trunk Utility Improvements 2026 $1,100,000 Sewer Utility 9/18/2019 7 Rate increases maintained at 5% by delaying improvements. Total CIP (2019-2028)2018 Study 2019 Study % Change Capital (Inflated) Capital (Inflated) Sewer $10,937,842 $12,278,443 12% Projected Usage Rate Increases 2018 Study 2019 Study Sewer 5.00%5.00% Sewer CIP 9/18/2019 8 Project Year Amount Average Debt Service Annually $65,000 Sanitary Lift Station Rehabilitation Program Annually $100,000 Street Improvement Program Annually $700,000 Inflow and Infiltration Abatement Annually $200,000 TH101 Imp-Pioneer Tr to Flying Cloud Dr (CSAH 61) 2020/2021 $500,000 Lower Bluff Creek Trunk Utility Improvements 2026 $1,800,000 Storm Water Utility 9/18/2019 9 Higher rate increases needed to pay for future capital projects. Total CIP (2019-2028) 2018 Study 2019 Study % Change Capital (Inflated) Capital (Inflated) Storm Water $7,549,494 $12,055,719 60% Projected Usage Rate Increases 2018 Study 2019 Study Storm Water 4.00%5.00% Storm Water CIP 9/18/2019 10 Project Year Amount Storm Water Pond Improvements Annually $300,000 Storm Water Infrastructure Maintenance/Replacement Annually $100,000 Street Improvement Program Annually $600,000 Comparison of Utility Bill -Neighbors 9/18/2019 11 Comparison of Utility Bill –KFS Cities 9/18/2019 12 Single Family Fee Comparison Neighboring Cities 9/18/2019 13 Single Family Fee Comparison KFS Cities 9/18/2019 14 Industrial Fee Comparison Neighboring Cities 9/18/2019 15 Industrial Fee Comparison KFS Cities 9/18/2019 16 Multi-Family Fee Comparison Neighboring Cities 9/18/2019 17 Multi-Family Fee Comparison KFS Cities 9/18/2019 18 #1 Reduce water hook-up fees Allocate more debt service to current and future customers #2 Change fee structure for multi-family units Count one apartment as .8 SAC units #3 Change timing of fee collection Collect more of fee with building permit instead of plat Options for Development Fees 9/18/2019 19 Reallocate debt on water treatment plants to: 30% -hook-up fees 70% -user charges Reduces water hook-up fees by 20% Requires a 6.25% annual usage rate increase (vs. 5%) Option #1: 20% Fee Reduction 9/18/2019 20 Many communities count 1 apartment as less than 1 single family unit due to lower water use Assumed 1 apartment = .8 SAC units Reduces water hook-up fees for multi-family by 20% Requires a 5.85% annual usage rate increase (vs. 5%) Option #2: Change Multi-Family Fees 9/18/2019 21 Currently 1/3 of fee collected at platting and 2/3 with building permit Developers prefer to pay all of it with building permit City could collect more or all fee with building permit, which would be better for developer but increases the financial risk to the City •City installs and pays for trunk line before permit is pulled. If development and receipt of fee is delayed, City would not be reimbursed in timely manner Option #3: Change Timing of Fee Collection 9/18/2019 22 2020 Sample Water Bill 9/18/2019 23 Base Line Option #1 Option #2 Quarterly Bill $78.05 $78.98 $78.68 % Increase 5%6.25%5.85% Assumes quarterly use of 26,000 gallons Water hook-up fees have been set to pay for 50% of water treatment plants that serve future growth Reducing water hook-up fees shifts water treatment costs to current and future ratepayer Policy discussion Summary and Discussion 9/18/2019 24 CITY COUNCIL STAFF REPORT Tuesday, November 12, 2019 Subject Approve City Council Minutes dated October 28, 2019 Section CONSENT AGENDA Item No: D.1. Prepared By Name, Department/Position File No: PROPOSED MOTION “The City Council approves the City Council minutes dated October 28, 2019.” Approval requires a Simple Majority Vote of members present. ATTACHMENTS: City Council Summary Minutes dated October 28, 2019 City Council Verbatim Minutes dated October 28, 2019 City Council Work Session Minutes dated October 28, 2019 CHANHASSEN CITY COUNCIL REGULAR MEETING SUMMARY MINUTES OCTOBER 28, 2019 Mayor Ryan called the meeting to order at 7:05 p.m. The meeting was opened with the Pledge to the Flag. COUNCIL MEMBERS PRESENT: Mayor Ryan, Councilwoman Tjornhom, Councilman McDonald, and Councilman Campion COUNCIL MEMBERS ABSENT: Councilwoman Coleman STAFF PRESENT: Todd Gerhardt, Jake Foster, Roger Knutson, Greg Sticha, George Bender, Bruce Loney, Chief Don Johnson, and Lieutenant Lance Pearce PUBLIC PRESENT: Larry Koch 471 Bighorn Drive Alan Nikolai 6570 Galpin Boulevard Jim G 3611 Ironwood Road Joe Green Minnesota Valley Electric Coop Dana and Mary Johnson 6671 Minnewashta Parkway Craig Mertz 8561 Osprey PUBLIC ANNOUNCEMENTS. None. CONSENT AGENDA: Councilman Campion moved, Councilman McDonald seconded to approve the following consent agenda items pursuant to the City Manager’s recommendations: 1. Approve City Council Minutes dated October 14, 2019 2. Receive Park and Recreation Commission Minutes dated September 24, 2019 3. Receive Planning Commission Minutes dated October 1, 2019 4. Receive Environmental Commission Minutes dated September 11, 2019 5. Approve Contract Amendment for Kimley-Horn for Minnewashta Parkway Project All voted in favor and the motion carried unanimously with a vote of 4 to 0. City Council Summary – October 28, 2019 2 VISITOR PRESENTATIONS. Larry Koch, 471 Bighorn Drive asked the City Council to consider proposed amendments to the Chanhassen city ordinances pertaining to surface water regulations, specifically to lower the slow no wake level to 895.8 feet on Lotus Lake and implement further restrictions. He asked that the City do a better job of cleaning leaves off of city streets, and concurred with the request to clean up the property at 510 Bighorn Drive. Ann Miller, 6561 Fox Path expressed concern about comments made by Dr. Dennis Petersen, Superintendent of Minnetonka School District that the district cannot rely on resident only students but needed open enrollment, and would like a refund on her taxes if the franchise fee passes. FIRE DEPARTMENT/LAW ENFORCEMENT UPDATE. Lt. Lance Pearce presented the monthly statistics for September, discussed community engagement programs such as the Citizen Academy, Coffee with a Cop, training, and staffing. Mayor Ryan asked Lt. Pearce to provide the non-emergency phone number for Carver County Sheriff’s Office which is 952-361-1231. Chief Don Johnson presented monthly numbers for September regarding staffing, calls for service, training, and open house activities. PUBLIC HEARING: MINNEWASHTA PARKWAY REHABILITATION PROJECT NO. 20-20: ORDER PROJECT AND AUTHORIZE PREPARATION OF PLANS AND SPECIFICATIONS. George Bender presented the staff report for this item. Councilwoman Tjornhom asked about plans to upgrade the intersection of Highway 5 and Minnewashta Parkway. Councilman McDonald asked for clarification of funding for this project as council members have been receiving emails citing the unfairness to residents along the road. Mayor Ryan asked for clarification of the traffic calming measures planned during construction, how the City will address those safety concerns, and clarification of the Parkway designation. Mayor Ryan opened the public hearing. Larry Koch, 471 Bighorn Drive encouraged city staff to really look at the storm water capacities along Minnewashta Parkway, and asked for clarification on the difference in cost between constructing a 7 ton versus a 10 ton design roadway. Mayor Ryan closed the public hearing. Resolution #2019-51: Councilwoman Tjornhom moved, Councilman McDonald seconded that the City Council adopts a resolution ordering the project and authorizes preparation of plans and specifications for the Minnewashta Parkway Rehabilitation Project No. 20-02. All voted in favor and the motion carried unanimously with a vote of 4 to 0. PUBLIC HEARING: CONSIDER FRANCHISE AGREEMENT ORDINANCES AND FRANCHISE FEE ORDINANCES. Greg Sticha presented the staff report on this item. Councilwoman Tjornhom asked if future city councils could change the use of franchise fees to fund items other than road projects. Greg Sticha explained that the current City Council cannot bind future city councils on the use of City Council Summary – October 28, 2019 3 franchise fees. Mayor Ryan opened the public hearing. Craig Mertz, 8561 Osprey Lane voiced his support for the franchise fee ordinances. Alan Nikolai, 6570 Galpin Boulevard asked if it was possible to do a two tier taxing levy, commercial at a higher rate than residential before explaining that he has a problem with instituting a flat fee of $5 per home regardless of it’s value, and a problem with shifting funds from the library fund to the street fund. He stated he does not support the franchise fee and feels that the issue should be decided by the voters in a referendum. Larry Koch, 471 Bighorn Drive explained his belief that a franchise fee is the most regressive tax you can possibly have and has the most significant impact on low and fixed income people. He explained that he does not approve of taking money that was approved for a library and all of a sudden shifting it to another purpose, explained that he does not think the City is raising enough money citing the condition of Frontier Trail which is not scheduled to be addressed in the 5 year plan, and issues with storm water drainage affecting the water quality of Lotus Lake. Ann Miller, 6561 Fox Path asked if the City has considered the use of toll roads in Chanhassen, and would like to see more roundabouts. Mayor Ryan closed the public hearing. After comments from council members the following motion was made. Councilman McDonald moved, Councilman Campion seconded that the City Council adopts the attached franchise agreement ordinances and franchise fee ordinances. All voted in favor, except Councilwoman Tjornhom who opposed, and the motion carried with a vote of 3 to 1. PUBLIC HEARING: CERTIFICATION OF DELINQUENT SEWER AND WATER ACCOUNTS TO THE COUNTY AUDITOR. Greg Sticha presented the staff report on this item. Mayor Ryan opened the public hearing. No one spoke and the public hearing was closed. Resolution #2019-52: Councilman Campion moved, Councilman McDonald seconded that the City Council adopts a resolution certifying delinquent utility accounts to the County Auditor. All voted in favor and the motion carried unanimously with a vote of 4 to 0. COUNCIL PRESENTATIONS. Councilman McDonald provided an update on a conference he attended regarding the future of public transportation using electric vehicles. ADMINISTRATIVE PRESENTATIONS. None. CORRESPONDENCE DISCUSSION. None. Councilwoman Tjornhom moved, Councilman McDonald seconded to adjourn the meeting. All voted in favor and the motion carried unanimously with a vote of 4 to 0. The City Council meeting was adjourned at 9:20 p.m. Submitted by Todd Gerhardt, City Manager Prepared by Nann Opheim CHANHASSEN CITY COUNCIL REGULAR MEETING OCTOBER 28, 2019 Mayor Ryan called the meeting to order at 7:05 p.m. The meeting was opened with the Pledge to the Flag. COUNCIL MEMBERS PRESENT: Mayor Ryan, Councilwoman Tjornhom, Councilman McDonald, and Councilman Campion COUNCIL MEMBERS ABSENT: Councilwoman Coleman STAFF PRESENT: Todd Gerhardt, Jake Foster, Roger Knutson, Greg Sticha, George Bender, Bruce Loney, Chief Don Johnson, and Lieutenant Lance Pearce PUBLIC PRESENT: Larry Koch 471 Bighorn Drive Alan Nikolai 6570 Galpin Boulevard Jim G 3611 Ironwood Road Joe Green Minnesota Valley Electric Coop Dana and Mary Johnson 6671 Minnewashta Parkway Craig Mertz 8561 Osprey Mayor Ryan: Again good evening. Thank you for your patience. Welcome to our City Council meeting. To those of you that are watching at home or streaming from the Chanhassen website, thank you for joining us and welcome. For the record we have 4 of our, 3 of our council members here with an excused absence for Councilwoman Coleman. Our first action is our agenda approval. Council members are there any modifications to the agenda as printed? If not we will proceed with the published agenda. We have no public announcements tonight so next up is our consent agenda. CONSENT AGENDA: Councilman Campion moved, Councilman McDonald seconded to approve the following consent agenda items pursuant to the City Manager’s recommendations: 1. Approve City Council Minutes dated October 14, 2019 2. Receive Park and Recreation Commission Minutes dated September 24, 2019 3. Receive Planning Commission Minutes dated October 1, 2019 4. Receive Environmental Commission Minutes dated September 11, 2019 Chanhassen City Council – October 28, 2019 2 5. Approve Contract Amendment for Kimley-Horn for Minnewashta Parkway Project All voted in favor and the motion carried unanimously with a vote of 4 to 0. VISITOR PRESENTATIONS. Mayor Ryan: We don’t have anything on here but are there, is there anyone in the audience that would like to come forward? Mr. Koch. Larry Koch: Good evening. Thank you and I have a couple things to go over and I’ll do it quickly. I submitted some request forms rather late. Let me go over them very quickly so I don’t have to take up your time. I want to present to you for your consideration in the future as proposed amendments to the Chanhassen City Council city ordinances pertaining to our surface water regulations. Namely to lower the slow no wake level to 895.8 feet. Limit our wake enhancing boats to slow no wake speeds at all times, at all levels. Require counter clockwise direction at all times and locations on Lotus Lake. Limit skiing and if allowed wake surfing from 7:00 a.m. to sunset except for Sundays, limit it from 9:00 a.m. to sunset. And reduce the speeds after sunset and before sunrise to 5 miles an hour. You’re already fully familiar with the issues having to do with the wake boats and I refer you to the report by Mr. Robert Merrit that was submitted at the public open house on that basis. The reason for the, I want to add the importance I think of the counter clockwise direction. The times is because this lake, Lotus Lake in particular is very, very narrow and it already has basically one direction when you’re outside of the current 100 foot slow no wake but even within that it is very confusing when you have boats on that narrow lake going clockwise within that area and so for consistency purposes we, I believe in fact that it would be better to have one consistent rule going counter clockwise regardless of whether you’re in the slow no wake or outside of that. It is very confusing. Other people have said so and I think it’s really a safet y issue and this goes back to the enhanced wake issue. It’s really a safety issue. A safety issue for the lake and it’s habitat. So I’m going to leave this for the record. I have two other things I just wanted to address that I submitted paperwork on and that has to do with street cleaning and leaves in the streets and it seems to me we have a lot of our citizens who are not doing a very good job of cleaning the leaves out of the streets and in addition we have a number of city streets that we don’t have people living on them and it’s, you know they’re boulevards and there’s a lot of leaves there and as we all know eventually those leaves end up in the storm sewers either to end up floating into our holding ponds or our lakes or they end up sitting in there rotting and then the City has to go and clean them out and dredge them and I would like the City to look into some way to cajole or get people including the City itself to clean up these gutters from these leaves. You know we’re Chanhassen, it’s because we have the maple leaves and it is a particular problem on that basis, and I’ll just note on that I’d like the City to look into this, I know that the City just purchased one of the more recent or newer vintage street sweepers and I know that Riley-Purgatory-Bluff Creek have contributed to that. I really would like to see that used you know more often, especially in the fall along the city streets that have just boulevards. People don’t live along them in particular and then I know Chanhassen City Council – October 28, 2019 3 there’s a couple of areas in Chanhassen that have particularly dense foliage that I think it would be appropriate to consider using it in those locations. And the last item that I want to bring up is the fact that I noticed in the Minutes that my neighbor Annette spoke last time about her concerns about 510 Bighorn Drive and I just want to echo her concerns, and this has been going on for quite some time. I know the City has been involved on and off for a period of time but we fully, my wife and I fully support her. I’m in a position where I don’t have to look at it all the time but unfortunately her family does and I really encourage the City to do something about it because it really detracts from the neighborhood and our city so those are the items. I’ll have some comments on your franchise fee but that’s it for right now. Mayor Ryan: Perfect, and did you Mr. Koch did you submit everything online so we’ll be able to see it? Larry Koch: I did as well as I have actual copies of these, of the letters so. Mayor Ryan: Alright well we’ll get it sent out because we didn’t obviously get a chance to review it in front of time but we will take a look at your requests. Larry Koch: Do you want me to give these to? Mayor Ryan: Sure if you want to give it to Jake that would be great. Larry Koch: Okay thank you very much. Mayor Ryan: Thank you. Todd Gerhardt: Mayor just a couple points of clarification. We do have two street sweepers. A mechanical one and a vac one that Riley-Purgatory did make a $30,000 contribution towards the acquisition of that vacuum sweeper. It’s our goal to try to sweep the streets at least twice in the fall and then we get out early in the spring to get the sand, salt up off the street before it goes into the storm water system too so those are our goals. And then we will do periodic cleaning if we started in an area and the leaves dropped again so we do work with residents on that. And Bighorn Drive, the property owner is back into the country and we have been in contact with him and he’s aware of the outstanding issues in front of him but as a part of the prosecution process we have to give him proper time to make those corrections and so he is on notice for that. Mayor Ryan: Perfect, thank you for the update. Any other visitor presentations this evening? Yes, please come forward. Ann Miller: Hello, Ann Miller, 6561 Fox Path, Chanhassen and I would just like to make a comment. Part of Chanhassen is within the Minnetonka School District and as you know the school board vote will be up on November 5th. I was alarmed when I received this in the paper and many of you may have too, a flyer and the Superintendent of Schools, Dr. Dennis Petersen Chanhassen City Council – October 28, 2019 4 of Minnetonka wrote in the last paragraph, the District could not, most certainly not live on the revenue of just resident students. This is regarding open enrollment so that’s what the context of that is. So what is alarming to me is, if the District, the school district cannot rely on the revenue of just the resident students, what about the taxpayers in our town? I’m very concerned about the franchise fee. I did pay my thousands and I think I need a refund if you grant it. Thank you. Mayor Ryan: Thank you. Any other visitor presentations? Okay. FIRE DEPARTMENT/LAW ENFORCEMENT UPDATE. Mayor Ryan: Next we have our fire department and law enforcement update. Lieutenant welcome. Lt. Lance Pearce: Madam Mayor, council. I’d like to cover the September activity for the sheriff’s office. In September we had 426 traffic related incidents resulting in 4 DUI arrests. We had 289 total traffic stops. Responded to 41 total crashes and we issued 87 citations. Last month I covered 17 citations in August for the cell phone use and that has gone down to 11 last month so hopefully we’re educating and informing people of the law there with that change. As far as our crimes last month we had 35 felony level crimes and 12 misdemeanor crimes. Of those, as we’ve seen in the past have been dominated by felony theft and drug related cases. Other activities as far as our community engagement. Our citizen academy started September 19th. We have 10 people that are participating in that. We also did Coffee with a Cop down at Starbucks on October 2nd. That was a relative success and we’re going to try to do that again probably in January so stay tuned for that. But last months activities mainly focused on traffic safety. With school starting we had the deputies kind of doing some extra enforcement around the school routes with school back in session. Training last month. The deputies focused on crisis intervention training and, which included some scenario based training. And update on our staffing. Deputy Bill Morrows who was assigned to the city of Chanhassen has moved onto the city of Cottage Grove as a police officer so we wish him well in his future endeavors and that does leave our power shift vacant temporarily. We should be filling that next month. Mayor Ryan: Great. Lt. Lance Pearce: The only other item to note is this Thursday with Halloween the deputies working the night shift should be carrying candy so if you guys see them they should be out and about. Mayor Ryan: Great thank you. Council any questions? I have kind of question comment. You know we get a lot of emails about who to call if there’s a certain situation that’s non emergency. Could you, not to put you on the spot but do you know the non emergency number off the top of your head that you should share it? Lt. Lance Pearce: I do. It’s 952-361-1231 goes directly to our dispatch center. Chanhassen City Council – October 28, 2019 5 Mayor Ryan: Okay. Lt. Lance Pearce: So that can be used in things that you don’t believe are an emergency but we certainly encourage people to call 911 if they don’t know. Mayor Ryan: Okay perfect. Lt. Lance Pearce: And that will probably get a little quicker response. Mayor Ryan: Perfect. Thank you for sharing that. Lt. Lance Pearce: You bet. Mayor Ryan: Thank you. Lt. Lance Pearce: Anything else? Mayor Ryan: I don’t think so. Thank you. Welcome Chief. Chief Don Johnson: Good evening Mayor and council. It’s the fire department report for the month with activities from September. We’re still, our staffing is stable at 43. The fire department responded to 85 calls for service again in September. One chief only call, 23 day calls and 28 duty crew calls leaving only 33 all calls for the month. Our duty crew calls years to date are at 192. Notable for the month, 44 rescue EMS calls with 8 motor vehicle accidents and to hear the sheriff’s office responded to 41 different incidents, our 8 were on serious injuries so, or unknown injuries so, kind of a big different there in regards to the number of accidents on the roadway. And just for this year we are starting to see more that we’re responding to so be careful out there when you’re driving so. We’ve had 6 responses to, for fire. Four building fires. A bath fan fire on Pheasant Circle, a lightning strike fire on Stone Creek and two mutual aid responses. One to Minnetonka and one to Eden Prairie. Training for the month was focused on our open house and fire prevention activities. We did, also did a pre-planned walk through with the new Riley Crossing building that’s ready to open and the next 2 nights we’re working on, or the next 2 Monday nights we’re working on auto extrications so our big highlights for activities was our open house. We spent a lot of time getting ready for that. It was a tremendous event. I think it was probably more well attended since we’ve switched to Monday nights in my time as chief so kudos to the entire fire department. I think we were 3 short for the night. Everyone else responded that night to work with the public and we get a lot of praise for what was going on and a lot of credit to Fire Marshal Nutter continues to find new ideas on ways that we can send our public safety message so. I will be working duty crew on October 31st so I’ll be finding the police cars with candy and so that’s all. I can stand for questions. Chanhassen City Council – October 28, 2019 6 Mayor Ryan: That was good Chief. Council any questions? A couple things I want to just acknowledge and say thank you for your community outreach. I know that the open house that you did, like you said was very well attended and really appreciated and valued by the community members so I know that’s additional hours but appreciate that community outreach for all of our residents here. Also I was made aware about, I know it’s daylight savings but I know there’s a public service announcement that always come with daylight savings so I wanted to plug that so you can make that public service announcement. Chief Don Johnson: Thank you Mayor. Smoke detectors. Batteries. I know a lot of our new homes are coming with sealed batteries so you just have to replace them after 10 years but smoke detectors in your home are good for 10 years but we’d like you to change your batteries at daylight savings every time, or every 6 months so make sure you’re keeping up on that. Mayor Ryan: Okay. And then last but not least I heard from a resident that you helped out, how much they appreciate you stepping in and helping out so thank you for that. Chief Don Johnson: You bet. Mayor Ryan: Alright, thank you. Chief Don Johnson: Thank you. PUBLIC HEARING: MINNEWASHTA PARKWAY REHABILITATION PROJECT NO. 20-20: ORDER PROJECT AND AUTHORIZE PREPARATION OF PLANS AND SPECIFICATIONS. Mayor Ryan: With no old business we’ll move into our public hearings and first tonight we have a public hearing for the Minnewashta Parkway rehabilitation project. Who’s going to take the lead on that? Mr. Bender. George Bender: Good evening Mayor and council members. At the last council meeting we called the public hearing which we’ll have tonight. Prepared a similar presentation to the last meeting to kind of go through for any new public that would be here tonight. Go through that quickly. And so to start the project, the intent was originally to work with Victoria to create a new paved surface from Trunk Highway 7 south to Trunk Highway 5 and the city limits end about 850 feet or so north of Highway 5 and the thought was you know there’s no point in the roadway getting redone just in Chanhassen and then having a short stretch that is similar to it’s current condition. Through additional research at the beginning of the project we found out that the City of Chanhassen owns the right-of-way for Minnewashta Parkway from the city limits which are near Hawthorne Circle south all the way to Highway 5. That research showed, or identified that in 1992 Victoria ceded this right-of-way to Chanhassen through a decision of the Municipal Board. The reason that this was completed was if one entity owns the right-of-way along the entire stretch Minnewashta Parkway can be eligible for State aid funding. So basically Chanhassen City Council – October 28, 2019 7 850 feet of new scope were added to the original project limits so that we will have that new pavement surface from Trunk Highway 7 to Trunk Highway 5. This is a new part of the presentation from the last meeting but some of the MnDOT State aid requirements in order to be eligible for State aid designation and hence the associated funding the roadway must be classified as a collector or arterial and Minnewashta Parkway is designated as a collector according to Chanhassen city code. The roadway must tie to another State aid or Trunk Highway facility which it does on the north where it’s tied to Trunk Highway 7 and on the south where it’s tied to Trunk Highway 5. The State aid program, it’s designed to create an integrated network street system that’s up to the proposed traffic which you know our Minnewashta Parkway currently on the south end is about 2,000 vehicles per day and on the north end it’s up to about 2,400 vehicles per day. And it acts as a relief for the trunk highway network. As part of utilizing State aid funding there are certain requirements associated with the design that must be met. A minimum of 30 miles per hour design speed. They have typical sections, lane widths, clear zones, no parking provisions and other things that have to be met including design capacity. It needs to have horizontal and vertical alignment and profiling. And it has a minimum pavement design which is greater than our city standard residential street design. And another main item is the local agency may not restrict vehicle use on a state aid roadway. So the proposed project scope is a mile and a half of street rehabilitation which is going to consist of full depth pavement reclamation. Trail reclamation. New ADA pedestrian ramps. Watermain replacement. Sanitary sewer rehab where needed. Sanitary forcemain replacement from the two lift stations. Lift Station 5 and, or sorry. Lift Station 6 and Lift Station 7. Storm pond improvements. There will be 3 ponds that are proposed to be maintained on the south end and retaining wall improvements along the corridor. So one of the main drivers of the pavement rehabilitation technique that was selected which is full depth in lieu of the mill and overlay is related to the watermain rehabilitation. The south half essentially to two-thirds is constructed of ductile iron pipe. The north is constructed of cast iron pipe and that transition happened due to when the original pipe was installed. In the early 70’s that’s when the manufacturing in the United States switched from primarily manufacturing cast iron pipe to duct iron pipe and that became the main material availability. The City has an established policy when there’s opportunity due to street projects to replace cast iron pipe. This is due to it’s repeated deterioration that we’ve seen on projects and you know making sure that when we put a new rehabilitation project over the top of it and we don’t want to be accessing it again for quite a while, hopefully up to about 40 years so we have to look at you know whether it will make it through the cycle without repeated additional costs due to main breaks. What’s interesting and unique along Minnewashta Parkway, through our main break research is that the section that was constructed of ductile iron pipe is the section that has the documented break history. So that essentially tells the engineering department that you know this early ductile iron pipe is you know, we’re having issues with it in this area and that’s something that we should take care of. There is you know over we’ve presented before there’s 10 breaks in this area. So early in the project the decision was made instead of just replacing all the cast iron pipe that we should replace all the watermain along the entire length of the project which is in the neighborhood of 7,700 feet. In order to keep this project from becoming a full reconstruct project it was decided to investigate trenchless technologies in order to replace this watermain. In looking at it we can Chanhassen City Council – October 28, 2019 8 keep the project from becoming a full reconstruct project which would lead to additional expense by utilizing these technologies and we investigated directional drilling new mains. Lining the existing pipe and pipe bursting the pipe and pipe bursting is the preferred choice. So here’s an exhibit that essentially shows that the limits are that red line that’s kind of by Glendale Drive. It’s cast iron pipe to the north and ductile iron pipe to the south. The sanitary sewer rehabilitation. Basically we ran a camera through all of the lines and you know reviewed them. There are certain ones that have been identified as needing rehabilitation. There are 6 segments total from manhole to manhole and you know those are proposed to be, have a liner and cured in place. The forcemains from Lift Station 6 and 7 have also been identified for replacement. They are, they were constructed of cast iron pipe and they also have a break history associated with them. Sanitary manholes will also be rehabbed which is probably going to be in the chimney sections to avoid infiltration through the adjusting rings and castings. For the storm water improvements, an analysis was done on the existing system from a pure capacity perspective to identify whether any improvements need to be made as part of the project and it was determined that the existing system is sized appropriately and adequate for future including you know where we see development occurring along the corridor. There is a significant amount of rehabilitation that needs to be done to the structures including casting and adjusting ring replacements. Up a level to the manhole reconstruction and also complete replacement of certain structures. We reviewed the storm ponds that are along the corridor for, you know need to be cleaned. And we also identified one that it makes more sense to eliminate than it does to even clean. It’s a very small pond by Lake St. Joe. The pond as it was originally designed has completely failed. Essentially when the water comes in there’s no way for the velocity to come out of it. It blew out the berm and you know we feel that replacing it would not be successful. We would have the similar or same problem and in order to address this we are proposing to put a sump structure in, in the street in the catch basin and do routine cleaning on that and then connect the inlet and outlet pipes that are currently there. They’re separated and deteriorated but run new piping down to the lake. There are two other ponds near Lake St. Joe that has significant sediment accumulation and we’re proposing to remove this material from the ponds and also the volunteer tree growth that are surrounding the ponds. Another thing is we early on in the project approached Minnehaha Creek watershed district of which this Minnewashta Parkway is within and due to we’re not really creating any new impervious surfaces. There’s some but it will be less than the requirement of 10,000 square feet. There is not a requirement for additional stormwater quality treatment or rate control. Construction phasing. When this project started we were looking at being able to do the entire corridor within one construction season. Due to the significant increase in the amount of work it is no longer deemed a mill and overlay project. The full depth reclamation. The watermain replacement and you know just the overall impact of the residents we feel that two seasons would be appropriate for this particular project length. This will allow the residents to essentially go north or south depending on which section is being done. The feasibility report that was prepared by Kimley-Horn considered this and they proposed constructing the southern half in the first year, and this would be from around Kings Road to, down to 77th Street. And that would leave the northern half to be done in year 2 up to, from Kings Road to Trunk Highway 7. As part of the second half, when we’re doing that. We’re sending the residents and users of the parkway out to the south, we’re proposing a Chanhassen City Council – October 28, 2019 9 temporary signal be installed at the intersection of Trunk Highway 5 and Minnewashta Parkway. Estimated cost summary. For the street improvements they’re proposed to be around $2.2 million. The watermain improvements have, went up significantly up to about $2.3 million from what was originally proposed which was just replacing the cast iron main. Sanitary sewer improvements are $385,000 and storm sewer improvements are $371,000 for a total project cost of $5,254,000. In order to fund this amount we’re proposing a little over $2 million dollars of our municipal state aid funding be used. The surface water utility fund take care of the storm water improvements. Sanitary sewer fund take care of the associated sewer improvements. The water utility fund take care of the watermain replacement. There’s a small amount of special assessments proposed to be to 37 properties in the amount of $165,000 and that is, you know adds up to the total amount of the estimated project cost. Proposed schedule was to have the public hearing tonight. Approve plans and specifications. The last meeting of the year on December 9th. Have a bid opening in January. A neighborhood meeting in February. Have an assessment hearing in March. Start construction in the spring of 2020. We’re estimating around 16 weeks of construction in both 2020 and 2021. You know we would shut down for the winter obviously. Start back up in the spring of 2021 and complete it somewhere around October of 2021. So for there I’ll stand for questions. Mayor Ryan: Thank you. Council before I open the public hearing do you have any questions? Yes Councilwoman. Councilwoman Tjornhom: I’d like to address the issue of the intersection of Highway 5 and Minnewashta Parkway. What are the plans for that? Are there any plans moving forward? George Bender: As part of the Arboretum Area Region Transportation Plan, that intersection is under consideration for that, that’s being done for the study. There’s not a date for it but they’ve considered a couple of, they considered the do nothing approach which is not what they’re looking at. They’ve considered a roundabout and they’ve considered a signal. The Arboretum is actually proposing to realign their entrance to be the southern leg of that intersection and as part of that a four way signal is the lead option in that study right now. That study does not include a timeline for when exactly the work would happen so I can’t really comment on that so it will be when there’s funding available I think. Councilwoman Tjornhom: Thank you. Mayor Ryan: Councilman McDonald. Councilman McDonald: Yes thank you Mayor. What I want to address is a little bit about the funding of how all of this is being paid for. A lot of the emails that we have been receiving concern funding and also concern somewhat the unfairness of how this is being funded as far as being paid for by the residents along the road. As I understand it, and tell me if this is correct or not but the road is being built to a 10 ton limit, is that correct? Chanhassen City Council – October 28, 2019 10 George Bender: That is correct. Councilman McDonald: And what the City typically looks at is a 7 ton road for residential streets. George Bender: That is correct. Councilman McDonald: So in the process of paying for this, is it true that really all the residents would be picking up is the cost of a 7 ton road and then the delta would be paid for out of the MSA funds? George Bender: That is also correct. Councilman McDonald: So that really in effect when we look at how we’ve I guess funded past MSA roads in the past in other neighborhoods and everything it is a fair comparison to say that really the residents only pick up what we would normally do as far as a city residential road and that’s what they’re going to be assessed for. George Bender: That is what is being proposed. Councilman McDonald: Okay. And then some of the other issues that have been brought up is about the traffic that’s on Minnewashta Parkway. There is truck traffic but again that’s because it’s a connector road and it’s built for a 10 ton usage. And I got one email about the fact that that takes away from it being a parkway but today we have trucks going back and forth on that road. George Bender: There is truck traffic along Minnewashta Parkway. During this summer there has been an increased amount of truck traffic due to construction projects on the north side of the lake. With the seasons changing that should diminish. The other thing that I could comment on is over the last decade there have been the engineering department has been working on reconstruction projects along the north side of the lake and this one was the last one. One of the main reasons that there was more traffic along Minnewashta Parkway is into the project that’s Orchard Lane there is not a left turn so if they’re using Trunk Highway 41 coming from the east. Driving westbound to approach that project there is not a left turn into that project area so they kind of need to make a right hand turn. Councilman McDonald: Okay. And then once all this construction is completed is it your opinion that things will kind of go back to normal the way they have been? George Bender: Yes. Councilman McDonald: Okay. George Bender: We don’t have any control or regulations on who uses the roadway. Chanhassen City Council – October 28, 2019 11 Councilman McDonald: Right but yes as far as everything, again the old pass were because they were probably the shortest pass and now because of construction people are using this as detour to get from Point A to Point B but again I would ask that Minnewashta Parkway was designed for just that purpose. To act as a connector for trucks between 7 and 5 and 5 and 7. George Bender: Yes it does. Councilman McDonald: Okay. George Bender: Assigned for that. Councilman McDonald: Thank you Ms. Mayor. No more questions. Mayor Ryan: Thank you councilman. Councilman Campion. Councilman Campion: Not at this time. Mayor Ryan: Okay. Mr. Bender I’d like to follow up on a couple questions that Councilwoman Tjornhom and Councilman McDonald made. When Councilwoman Tjornhom asked about the highway, the intersection of Highway 5 and Minnewashta Parkway, I know the long term plan for the Arboretum study is what you explained but I think the concern that we have been hearing from residents is what’s going to happen during the construction season and I know that it’s in the feasibility report that there is, that we’re going to request it or we’re proposing that they do something. How do we make sure that there is something because when we go through traffic volumes of 2,000 per day on one end and 2,400 cars per day on the other end, that’s a lot of cars and it’s already significantly backed up as you know during rush hour. Is there anything that we can do from a City’s perspective to make sure that there is some traffic calming measures in that intersection? George Bender: The plan is to continue to work with MnDOT on this throughout the winter. MnDOT has already been approached with this topic. They didn’t immediately say no and, but there’s not a, we haven’t received a formal yes from them at this point either. That’s kind of more of a final design element as we’re going through that. Kimley-Horn has been asked to work with MnDOT and reach out to them and talk to them about this. Schedule meetings to discuss it as necessary which you know I’m confident they are doing. Mayor Ryan: Okay. George Bender: But at this time we do not have a formal yes, that will be fine and you can include that as part of your project. Chanhassen City Council – October 28, 2019 12 Mayor Ryan: Okay, so I don’t know if this is a question for you Mr. Gerhardt or a legal question Mr. Knutson. You know I think that safety is going to be a real concern, I mean other than the annoyance of having long lines to try to access Highway 5 during any time of the day but specifically rush hour. How does the City put pressure on MnDOT to do something about it? Is it reaching out to our legislators and commissioners and residents calling? This is out of you know all of the concerns that have been put forward I think this is the number one concern because without the construction it’s, it’s a challenging situation and when we add this element to it I think it’s above all else it’s a huge safety concern so how do we as a city? Todd Gerhardt: I think Roger would agree with me. All of the above Mayor and council members. But I think the key element here is to work with MnDOT. Kimley-Horn has a wonderful relationship with MnDOT and works on a variety of projects but other communities where MnDOT is involved and they work directly with MnDOT on their own projects so, and I believe we have a good working relationship with them and in coming up with a safety plan as a part of any work that would go on on the south part of Minnewashta Parkway and then on the north part, you know a couple of things come to mind is timing of the signals at Bavaria and Rolling Acres Road you know to provide more gaps. If it needs traffic control situation. That would be an extreme but I know that setting the signals at those intersections and at 41 and Highway 5 and 41 and 7 would greatly help create a gap for those people trying to get out of Minnewashta. George, Bruce anything outside of that that you can think of? Bruce Loney: No I think what you said is perfect. You have to continue to ask MnDOT and show and I think the Arboretum started and George has been attending is a proper place to put our concerns there and tell them about our project and can we get an expedited decision. That’s what we want. We don’t want to be waiting to let bids and still be hanging out there not knowing. We’d like to get it done by the time we authorize bids. Todd Gerhardt: Yeah I think the Arboretum study is definitely the long term solution to this situation but during the construction periods there’s going to be some delays with truck traffic coming and going with bituminous and Class V and pipe but you know we’ll try to work with MnDOT on some type of traffic control and signage is typically what happens with projects like this. Mayor Ryan: Okay thank you. And then just a simple question because as Councilman McDonald mentioned we received a lot of emails in terms of the parkway and save the parkway and keep it a parkway. Just for clarification is there any differing set of standards other than the 7 ton versus a 10 ton in why it was called a parkway versus a road or is it really constitute the same application as a road. Minnewashta Road or if it was called Minnewashta Road or Street or anything else. George Bender: I did try to do some research on this today. I believe parkway is just pretty just a name. Chanhassen City Council – October 28, 2019 13 Mayor Ryan: Okay. George Bender: I don’t know how long it’s been named Minnewashta Parkway. It used to be a county road. At the same time there is numerous, it’s very common for county roads to also have an additional name associated with it. I know the roadway has been there for a very long time because that’s one of our older plats along Red Cedar Point Road and even along the north side those are also older plats up there and you know so people have been coming to this area for a long time. As far as parkway to me that probably references scenic views along a thoroughfare. Landscaping. Sometimes it may include a divided median which is you know for the width of the existing roadway that we have and that this is a reconstruct. Not a reconstruction project that does not really bode for a change. For the current geometry. But along the ways of I do think it’s scenic. You know landscaping could be looked at if the council wanted to you know try to make improvements along that corridor. But you know primarily I don’t really feel that parkway has a whole lot to do, it kind of means other modes other than just vehicular transportation to me you know for pedestrians and bicycles and we do have a continue trail from the north to the south end so that kind of goes along with it. There’s nothing that the parkway designates that actually means that we have to be doing something different as far as I’m aware. Mayor Ryan: Okay thank you for that clarification. And then last just to reconfirm, I did see it in your slide. It was one of my questions that it said because it’s a state aid highway we have to keep it at 30 miles per hour so I know there’s some legal changes that now we an lower speed limits to 25 but if we want to accept the state aid we have to keep it at 30. George Bender: Correct. Mayor Ryan: Okay. Because I know that was another concern about lowering the speed limit. Todd Gerhardt: George could bring that slide back up. You know the designation of, what MSA is it’s a Municipal State Aid roadway and the City receives approximately $1 million dollars a year in state aid funds from the State for such roads like Minnewashta Parkway and we use those dollars to help with the reconstruction of what are the major collector roads that Minnewashta Parkway does and some of the parameters of receiving that money you must have a minimum of 30 miles an hour. There has to be a typical section of a lane width out there and then it also has to have a minimum ton pavement strength and, which is 10 ton and if you could go to the slide to show how much of our state aid that we have allocated to this of the $5.2 million dollars. We’re using almost 2 years worth of municipal state aid funds to help offset the construction which is close to about 50 percent and the assessments are around 3 percent of the overall project cost so without the municipal state aid standard you know we would have to look at other funding sources, either through a tax increase. Franchise fee. Some other way of funding instead of using the $2 million dollars we receive in the state aid. Mayor Ryan: If we wanted to change any of those elements. Chanhassen City Council – October 28, 2019 14 Todd Gerhardt: Correct. Mayor Ryan: Okay perfect. Alright thank you council, any. Oh go ahead Councilman McDonald. Councilman McDonald: We were talking about Highway 5 and Minnewashta. I thought I saw in your presentation that you were looking at some kind of a temporary signal down there. What is that? If it’s not a stop light what are we talking about? George Bender: We are talking about a stop light. Councilman McDonald: Okay. George Bender: So they make temporary signals. We wouldn’t have to necessarily go with the wooden poles and hanging wire across the roadway. They make them that are trailer mounted and can kind of pop up there and be easier to remove which I expect may be a concern of MnDOT because once the signal is in place they certainly may get some feedback related to how much we like it. Councilman McDonald: Yeah that’s why I was wondering. Can we use that to again bolster our point that there needs to be a light there? George Bender: I think it may naturally do that. Councilman McDonald: Okay. George Bender: Whether they like it or not. Councilman McDonald: Okay good. Todd Gerhardt: If you go to the intersection of 41 and Lyman, those are temporary signals that have been there for 30 years. George Bender: They’re going to get a roundabout now so. Mayor Ryan: Alright thank you. With no further questions I will open the public hearing. Please step forward and state your name and address for the record. Larry Koch: My name is Larry Koch, 471 Bighorn Drive. I have one comment in particular and I have no doubt that Minnewashta watershed district you know has done it’s analysis and I’d just encourage city staff to really look at the storm water capacities because the information being given to me is that the increase, really increase moisture levels for who knows how long and it’s Chanhassen City Council – October 28, 2019 15 going to be stressing a lot of existing infrastructure particularly stormwater solutions so I just encourage everybody before they get to that to double check those because as we all know that’s a very expensive project, to try to redo on that basis. And then the last comment I have is, how much would it cost to, I mean if you did nothing is there a need to do anything actual need? George Bender: Can you expand on what you’re referring to? Larry Koch: Well on the Minnewashta update itself. I mean is it deteriorated to the point, does it otherwise meet our standards for being deteriorated that it has to be redone at a 10 ton level as opposed to a 7 ton level because it’s sufficient if it’s just 7 ton and if 7 ton would actually be sufficient what would it cost us to do it at a 7 ton level because we wouldn’t be getting the state aid. George Bender: The difference between a 7 ton design and a 10 ton design is pretty much about an inch of bituminous so there’s, in our 7 ton design our standard detail is 4 inches of bituminous so this project will include 5 inches of bituminous. So an additional 20 percent in bituminous cost is pretty much the difference which you know from a, I don’t have the numbers in front of me. That would have to be different but I would think that that would be in tune of somewhere between $100,000 and $150,000 difference. Larry Koch: And one last question. When it applies to our other streets, when we reconstruct do we reconstruct to 7 ton? George Bender: On a residential street? Larry Koch: On a residential street. George Bender: Yes. Larry Koch: Okay so all reconstruction gets done at the 7 ton level. George Bender: Yep. Larry Koch: Okay, very good thank you. Mayor Ryan: Yep, and Mr. Koch as Mr. Bender had pointed out in our ordinance that this is identified as a collector road and that’s why we’re, it has to be designed to a 10 ton standard. Larry Koch: I understand that. I was just trying to get a picture of the difference in cost between you know doing the 10 ton versus the 7 and you’ve given me that answer so thank you very much. Mayor Ryan: Perfect, thank you. Chanhassen City Council – October 28, 2019 16 George Bender: I can comment maybe a little bit on your first point as well. When the capacity analysis was done to the storm water it was with our newest rainfall calculations that are out there. It’s Atlas 14 Method for prediction so that’s the current version that is heavier than the previous versions that were being used. Mayor Ryan: Great thank you. Anybody else like to come forward? Okay with that I will close the public hearing and bring it back to council for either further questions, comments or action. Councilwoman Tjornhom: I’d like to make a motion. Mayor Ryan: Yes Councilwoman. Councilwoman Tjornhom: I’d like to make a motion that the City Council adopts a resolution ordering the project and authorizes preparation of plans and specifications for the Minnewashta Parkway Rehabilitation Project Number 20-02. Mayor Ryan: We have a valid motion. Is there a second? Councilman McDonald: I’ll second. Councilman Campion: Second. Mayor Ryan: Councilman McDonald give you the second. With a valid motion and second all those in favor please signify by saying aye. Resolution #2019-51: Councilwoman Tjornhom moved, Councilman McDonald seconded that the City Council adopts a resolution ordering the project and authorizes preparation of plans and specifications for the Minnewashta Parkway Rehabilitation Project No. 20-02. All voted in favor and the motion carried unanimously with a vote of 4 to 0. Mayor Ryan: That motion carries 4-0. PUBLIC HEARING: CONSIDER FRANCHISE AGREEMENT ORDINANCES AND FRANCHISE FEE ORDINANCES. Mayor Ryan: Next we have another public hearing and it’s a consideration of a franchise agreement ordinances and franchise fee ordinances. Mr. Sticha. Greg Sticha: Good evening Mayor, council. Before I get too far in my presentation I just want to make a couple of comments. Public hearing this evening is certainly going to get a lot of discussion on the franchise fee portion of the ordinance adoptions. I do want to make a couple of public comments that we are also adding the franchise ordinances themselves that govern the Chanhassen City Council – October 28, 2019 17 right-of-way of the utilities within the city’s right-of-way so that’s an important part of this discussion this evening an eventually a potential vote if the council so chooses. One additional item of note I have included on the table over here a frequently asked question document that we’ve gotten from residents over the last couple years when the council has been considering this item. Some very lengthy responses to some relatively detailed questions. I’m not going to be going over all those questions. Some of them will get answered inherently throughout the presentation but I would encourage anyone who is here for this portion of the public hearing to go over, take a look at some of those frequently asked questions and I think some of them may be answered as part of a question they might have during the public hearing portion of the evening. So we’re going to hop right into it and I know the council has seen this presentation multiple times and then some in the audience probably have seen this presentation multiple times. I’m going to do my best to handle some of the engineering kind of portions of it as I’ve also heard the presentation several times so I’m pretty adept to some of the terminology and information that’s within the presentation. So the first 3 or 4 slides are going to be mostly discussing the existing conditions of some of our streets and why there’s an additional need for funding for our local roads. This first slide is intended to show the history of our OCI which is Overall Condition Index or the condition of our pavement on average throughout the entire city. As you can see dating back to 2010 there has been a decline in our OCI into the mid 2010’s. We did do an extensive project in 2015 which improved a lot of the very poor areas of town which resulted in a jump in our OCI in 2016 and ’17 and now we’re starting to see another decline in our OCI at this point in time. What does an OCI mean? What does that percent number that is associated with an OCI mean? This chart kind of breaks that out. It details what’s an excellent, a good, a satisfactory street. The recommended activity is what in theory the engineering department would recommend if a street had an OCI in that range, what type of treatment or maintenance or reconstruction would be needed. And then the cost per square foot to do each of those, for each of the various types of projects that would be associated with each. This slide is just mean to kind of give you an idea of what each of those OCI’s mean. So where are Chanhassen streets in terms of the OCI or condition index? 40 percent are in the good range. The 85 to 100. And then roughly another 40 percent are in the fair to satisfactory range which can range from 50 to 85 and about 20 percent are in poor range. As previously noted in the other slide once you get to the poor range you’re looking at most likely a reconstruction project and any maintenance dollars in terms of a mill and overlay probably aren’t going to be very effective. This particular slide was created last year. This last year and I think it’s a pretty important slide because it really I think hits home to why there’s a need for increased funding. My next slide is going to indicate that a street has a useful life or a rough life of about 50 years and if you look at the blue line in this graph that is the miles of streets that were built in Chanhassen by year going back all the way to 1960. If you correlate that to 50 years later the orange line corresponds to when you should be replacing those streets. So it being 2019-2020 what you’re starting to see is we’re approaching the point in time of when 50 years ago we started increasing the amount of miles of streets that were constructed in the city of Chanhassen to 2.7 miles per year and then eventually we get to more miles per year in the next 15 to 20 years. This particular graph actually should have been on the slide before but it visually depicts the, I’ll go back and show you the breakdown of the red, yellow, green and blue. This slide depicts where in our city are Chanhassen City Council – October 28, 2019 18 the red, yellow, green and blues. As you can see from the map a lot of the red and yellow is in the older part of the city. A lot of the blues in certain newer parts of the city. Some of the blues, and I’m sure engineering could count on this are probably roads that have had either some type of maintenance or reconstruction associated with it already. So the older parts of our city certainly are in need of either reconstructions or a mill and overlay and some of the newer parts of the city obviously not to that point yet but maintenance is certainly, if you ask any of the engineers ongoing maintenance is important to get you to that 50 year span for a street life. So as we’re talking about the average life being 50 years the next thing to account for is well how much per mile does it cost to replace those streets. When you’re doing a street reconstruction, the analysis that was done by engineering throughout the 1960’s and 70’s indicated we’re building about 1.6 miles per year at that point in time. We’re at about 50 years. 1.6 miles times $1.5 million, which is the approximate cost per mile for a street reconstruction project would indicate that the City should be spending about $2.4 million per year on reconstructions. Looking at a very similar graph but this time as it relates to mill and overlays, which are maintenance in nature, and should take place approximately every 25 years. So the blue line is the same as the blue line that you saw in the previous slide whereas the orange line here is 25 years later and as you can note by it now being 2019-2020 it would indicate that the City should be doing about 3 1/2 miles per year in mill and overlay projects throughout the city if you follow the theory of about 25 years a road would be due for a mill and overlay. Those streets were done probably in the late 80’s, early 90’s and again that was 3 ½ miles per year. It costs about $350,000 to do one mile of a mill and overlay. 3 ½ miles times .35 million equals $1.2 million per year. So what all this is indicating is a total spending on road improvements, whether they be maintenance or reconstruction, the City should be spending about $3.6 million per year for the maintenance of those deteriorating roads that were built some 50 years ago. What I am going to go over and that is a new item to the presentation that others may not have seen prior to this evening is the impact that increasing that funding from what we had previously been doing was an average of just under $2 million dollars a year in roads. There are other additional impacts aside from the cost of the road itself and in particular that relates to the utilities that are under those roads. Based on increasing the funding or spending on those roads, in particular related to street reconstruction projects, you’re looking at about additional $450,000 per year that would be needed for water system improvements. About $140,000 for sewer system improvements and about $375,000 for storm water improvements. Those amounts have been included in the 2020 rate study that the City Council saw back in September so those are included on the proposed rates that Ehlers and Associates had included as part of that presentation. So at this point in time there would be no need for an additional rate increase related to this additional funding on roads but we wanted to make it clear that yes we are completely aware that there is going to be additional costs related to the additional roads that would be done. The City Council is also considering an additional street department resources in the general fund for part of the 2020 general fund budget related to pothole patching. The council will be getting a detailed presentation by staff in a November meeting to consider that item in particular as it relates to just pothole and patching and not mill and overlays, sealcoating or any of the other items. Sealcoating will be a part of the discussion. I do know that so we’ll get into more detailed information as it relates to those small maintenance items. The funding for this evening that is Chanhassen City Council – October 28, 2019 19 being discussed would not be going towards any of that. On this slide what we’re attempting to do is put together a visual presentation of how many miles of mill and overlay streets, street mill and overlays could be done based on previous funding the City has put towards it and based on what the new funding could afford. So one of the things that we discussed with the engineering department within the last few weeks is if the funding is passed what would give the City the most bang for the buck for their dollar in terms of where would they put those resources towards and the engineering department indicated initially in the first couple years the most efficient and effective way to spend those dollars would be on mill and overlays. Maintenance of some existing roads that are probably, haven’t had any attention in 20 to 25 years and so the funding for this particular, under this particular scenario the engineering department is recommending roughly 15.2 miles of mill and overlays within the first two years of the new funding for the pavement management fund. Had the City Council continued spending about $2 million dollars per year towards those roads you’d be looking at roughly 8.7 miles of roads that you could do. As you can see in the yellow and blue lines indicated on top that’s a significant amount more of neighborhoods that the City Council will be able to have funded for mill and overlays. In addition the City Council did want included a potential list of streets that would be included for those mill and overlays and as we get into the next slide I do want to caution that while the engineering department I think is fairly certain in particular on the 2020 mill and overlay approach of this plan. Any of the years and all the years are subject to some change depending on the conditions of each of the roads in each of the neighborhoods so while you might see a road Ashton Court scheduled for a 2021 mill and overlay, that does not absolutely guarantee that a mill and overlay would be done on Ashton Court in 2021. A number of variables will come into account as it relates to that, in particular the conditions of those roads and of other roads that might need a mill and overlay sooner than Ashton Court as one example. Looking at the 5 year plan that the engineering department has put together in terms of where all the funding for the pavement management program would go. As the previous two slides indicated the first two years the majority of the funding would go towards mill and overlays. Starting in 2022 you would be averaging about $1.5 million per year towards reconstructions and about two and a half million per year towards mill and overlays. There’s a footnote at the bottom of this slide that also indicates that this does not include MSA funding reconstructions which over this time would be an additional 4.4 miles. You were talking about one this evening. Minnewashta Parkway so the numbers that we’re talking about this evening are non-MSA funded roads and do not include any of those that would be reconstruction projects spent with MSA dollars. So I’m trying to give the total picture here in that these are not the only roads that would be done over that 5 year span. This is simply a list of what it looks like. A list of all roads and when they would currently be estimated for either a mill and overlay or reconstruction. Again does not include MSA funding of reconstructions and is subject to change. So the next part of the presentation gets a little bit more into how to pay for the City’s share of the $3.6 million in additional roads. So one of the items I want to make abundantly clear and we’ve attempted to make very clear at our previous public meetings is the City Council has indicated and made it very clear to staff that the City Council will continue it’s current assessment practice. The practice of assessing 40 percent for mill and overlays and reconstruction projects to benefiting property owners will not change. The funding issue that the City has is for their 60 percent. Their portion of those projects. So any Chanhassen City Council – October 28, 2019 20 franchise fee or levy that would be issued has been indicated by this council and previous councils would be used only for local road improvements. Whether it’s a franchise fee or a property tax levy that has been the indication by the elected officials at this point in time. So then comes the question of why is the City considering issuing a franchise fee rather than a property tax and there are a few reasons behind that and I’m going to go into a couple of them here over the next few slides. Probably the most important reason is a franchise fee allows the City Council the flexibility to structure the franchise fee to have impacts on certain, certain customer bases within the utility companies total customer base whereas if the City issues a property tax only for all of these costs, total cost improvements roughly 83 cents of every dollar would be coming from a residential property owner. The proposed franchise fee that the City Council sees in front of them is structured differently so that that is not the case. As I stated a franchise fee offers more flexibility than a property tax levy. Under this proposed rate schedule the portion that is related, the portion of funding, the $1.7 million in funding in franchise fee would result in about a 63/37 percent split between commercial and residential properties whereas a property tax levy would be 83/17 obviously putting a little bit more of the burden on some of the commercial properties within the city by using the franchise fee. One other item of note, and I know we’ve brought it up at multiple meetings this summer. We’re fully aware that a franchise fee has the same impact as a property tax but this incentive of allowing for the structure to be a little bit differently and take a little burden off of the residential property owners has been an important part of the discussion that the City Council has had. This slide shows the proposed franchise fee schedule by customer class within each of the utilities generating the $1.7 million discussed earlier. So who has a franchise fee in the 7 county metro area? It’s becoming more do not, or do have a franchise fee than do not. All 7 of Chanhassen’s neighbors, neighboring cities have a franchise fee including Chaska, Eden Prairie, Excelsior, Minnetonka, Shakopee, Shorewood and Victoria. The majority of those are being used for local road improvements but it’s not extensively used by each of those cities for local road improvements. There really is no limitation on what the funds can be used for but it’s been very clear by this council and previous councils that the funding would be used for local road improvements only. So how do we get to the $3.6 million a year needed in funding? And some of the answer is the franchise fee but some of the answer here is also an increase in the property tax levy above and beyond the current property tax levy which is just over $380,000 that the City Council 5 years ago put towards it’s pavement management fund. City Council as part of it’s preliminary levy in September did include $350,000 as a potential possibility for the 2020 levy. In addition staff would recommend a portion of the library levy which is coming off the debt portion of the library levy in 2022, which is coming off in 2021 to be used towards the pavement management fund. The use of that particular levy would not result in a property tax increase as it would just be the shifting of the levy from the debt of the library building to the pavement management fund. So what would the total impact on a residential property be under this funding scenario with a franchise fee assuming a home has both a gas and electric utility and the $350,000 property tax increase that is proposed by City Council at this point in time for 2020, and this graph represents that. The franchise fee portion of that on all homes would be the same obviously. $120 per year and then the property tax increase would vary depending on the value of your home with a much smaller home such as a $200,000 home paying only $13 per year and a larger home paying as much as Chanhassen City Council – October 28, 2019 21 $80 per year in property taxes. Total cost we’re talking could range from $130 per year to just over $200 in total depending on the value of your home. One of the representations the council wanted to point out this evening is, this graph shows what would happen if the City Council continued to spend $2 million per year on roads or less, and even in this case you’re spending $2 million dollars every other year on your pavement management program and under this scenario in 2021 the pavement management fund would be out of funds. Under this particular scenario the only revenue stream that is going into the pavement management fund is the current levy of $384,000. Based on the graph we saw earlier spending $1.1 million per year towards our local roads is certainly not going to keep us up with the increasing demand of those roads that were built 25-50 years ago. This graph shows the funding with the new funding revenue streams that were discussed previously including the franchise fee as well as the property tax levy increase. It keeps the fund funded with a minimum reserve of about a half a million dollars for the next 10 to 15 years. Again these are based on a number of estimates. There are some things that could impact the projected fund balance in this fund including interest rates as well as if in one particular year the engineering department decided it was important to spend a little more than $3.6 million towards local road improvements and then the next year spend a little less. Having that small amount of fund balance would be crucial in having even the slightest bit of flexibility in determining when and how much each of the year’s projects while in a completely ideal world the top line indicates that we’re going to be spending $3.6 million per year adjusted by 3 percent inflation per year. Realistically some years it’s going to be $3.9 million. Some years it’s going to be $3.3 million and so, but over the life of the fund over the next 10 to 15 years we would project that the minimum fund balance would stay above the $500,000. So with that staff would recommend opening a public hearing to take input on the implementation of the franchise fee and the updated franchise ordinance which are included with all 3 gas and electric utilities. At that point in time the City Council could consider adoption of those ordinances. Mayor Ryan: Thank you Mr. Sticha. Council before I open the public hearing are there any questions of staff? Go ahead. Councilwoman Tjornhom: My question is referring to slide 14 and the comment or one of the issues, or not issues but, is it 14? Greg Sticha: I’m trying to make sure I get to 14. Councilwoman Tjornhom: It was a funding, no it was not. It was slide 14, sorry. Jake Foster: That’s 14 in the packet? Greg Sticha: This one here? Councilwoman Tjornhom: No. It’s what we have established at this point so it was close. Greg Sticha: Okay. Chanhassen City Council – October 28, 2019 22 Councilwoman Tjornhom: There we go, thank you. Greg Sticha: Okay. Councilwoman Tjornhom: Alright number 2. The additional funding is for financing the City share only. Last year that was an issue I had with the whole process and when you look at, I’m not going to even try the slide number anymore but the graph with other cities, yes they are using it for cities for their roads but also some just use it for their general fund. So I really want to know how this works. Would it be where this would be just established and the City Council, future city councils could never dip into this fund or these fees for another project? Or is this just something, it would go year by year where the City Council could decide if they were going to use these funds for roads or for something else they decided they needed? Greg Sticha: The franchise fee agreement is dated for 20 years. However the difference between a franchise fee and a property tax, a city council can change either of those at the same pace or level so whether the City Council decided to issue a franchise fee this evening or whether they decided to issue a property tax, in either case that cannot bind a future city council. So whatever funding stream you want to use there is no way to bound a future city council to say that funding will go only towards local road improvements. Now we’ve from a staff level standpoint we’ve talked about this item and on an annual basis we will be reviewing the balance in the pavement management program with the City Council. It will become an annual part of the budget process so it will be looked at multiple times every single year. So it’s not going to be a set it and forget it. The reserves that are in that fund will be reviewed by every city council every year as a part of the budget process. But whether you issue a franchise fee or a property tax levy increase to fund these roads any future city council can change either of those. Councilwoman Tjornhom: So it’s not set in stone then? That these fees would just go to roads. I’m just asking a question because that was my problem last year and so I just when I saw this in the power point that the city share only, that’s. Greg Sticha: I guess my answer is there’s no legal way to bound, bind a future city council. Councilwoman Tjornhom: City council for those funds. Alright thank you. Greg Sticha: And Roger or Jim can correct me if I’m wrong but. Councilwoman Tjornhom: Thank you. Mayor Ryan: Any other questions council? Alright I hereby open the public hearing. Please step forward and state your name and address for the record. Chanhassen City Council – October 28, 2019 23 Craig Mertz: My name is Craig Mertz, 8561 Osprey Lane in Chanhassen. Homeowner in the city for more than 40 years. I’m here to urge approval of the four ordinances for the pavement funding program specifically the franchise fee. This is not a perfect solution. It’s not a solution that’s going to be fair to 100 percent of the properties in the city. Perfection’s an elusive goal. 100 percent fairness is an elusive goal but the City Council shouldn’t be bypassing the good to try to seek the perfect and this is the best solution that I’ve heard. Mayor Ryan: Thank you Mr. Mertz. Alan Nikolai: Alan Nikolai, 6570 Galpin Boulevard. I have a question and I don’t know if it’s even possible but it was on the pie chart about commercial versus residential. Can you do a two tier taxing levy, commercial at a higher rate than residential to get the numbers skewed back to that I think it was 63/37 or something like that. Is that even legal or possible? Greg Sticha: If I understand your question correctly, if you look at the proposed charges on this chart a residential customer will pay $5 per electric and gas utility and if you look in comparison to a large electric commercial customer they will pay $290 for their electric utilities so under this proposal it has been created to have a larger dollar increase to be paid for by the commercial property owners. Now if you question is has the City Council considered even larger portion than that to. Alan Nikolai: I’m not talking about the franchise fee. I’m talking property tax levy. Greg Sticha: Oh you’re talking property tax levy. Mayor Ryan: Levy. Greg Sticha: The answer to that is no. The Minnesota State Property Tax system is structured based on the taxable market values in your town. So because over 80 percent of the total taxable market value of all properties in the city of Chanhassen are residential properties the City Council cannot alter that. Alan Nikolai: So you can’t do two tier, one commercial, one residential? Greg Sticha: Not for property taxes, no. Alan Nikolai: Okay. The second thing I guess I have is concern with the flat rate tax. $5 dollars per, doesn’t matter if you live in a $2 million home or if you live is a $100,000 home you’re paying $5 a month. Greg Sticha: Under this proposal yes. Chanhassen City Council – October 28, 2019 24 Alan Nikolai: I have a problem with that. You’re basically pensioners are going to be taking it on the beak with this franchise fee. The ones that least can afford it, they’re going to be paying as much as someone that really can afford it. Can the franchise fee be part of the property tax, what your assessed value of a property collected and that always may be a three tier. $3, $5, $7. $300,000 less, $300,000 to $700,000, $700,000 plus. See what I’m saying? Is that possible? Greg Sticha: Under the State Statutes you cannot charge different identical commercial and residential classes different rates for a franchise fee so the answer to that is statutorily no. Now one thing I would like to point out is while $1.7 million of the total funding we’re talking about is coming from a franchise fee under this proposal, an additional million dollars in total when it’s all said and done, assuming the council follows through with the preliminary levy it set and using the library levy in 2022, that total funding will be just shy of a million dollars and is based on the property tax system so it is based on value of home so a portion of the total funding for, under this proposal is based on property value and so if you look at this scenario just the $350,000 portion of the property tax increase that the City Council is considering for 2020, a $200,000 house is going to pay $13 dollars and a $1 million house is going to pay $82. So the proposal has been structured very carefully in that we have taken into consideration that concern, among other concerns, and tried to offset and weigh as many of those as possible to come up with something that’s equitable using both a property tax and a franchise fee. Alan Nikolai: I guess I don’t understand. You said you can’t have two different tiers and yet if you look at the commercial there’s multiple tiers. In the commercial you can do multiple tiers but residential you can’t? Greg Sticha: As long as they’re within different classes yes you can charge different rates. So residential there’s only one billing class for their customers in that billing class so the answer is in residential no. In commercial yes because there are different billing classes within that customer base. Todd Gerhardt: For electric and gas. Not taxes. Alan Nikolai: I understand but at the same time it’s kind of tying your hands because I’m just looking at the people on pensions or just on social security hardly making it, they’re going to be paying a higher percentage compared to someone that’s a, that can afford it and they living in a million dollar home. You know it’s just, I have serious concern about that. Another concern I have is basically borrowing from Peter to pay Paul on the library. That $200,000. That’s not crooked. That’s like saying the parks department oh we’re going to take $200,000 from the parks departments and we’re going to give over to the, so we can buy some new equipment for the city. Wait a minute. You’re baiting and switching there. If there’s that levy was supposed to be for the library why doesn’t it stay with the library? Or whatever department. Okay that’s supposed to be for say parks or streets, you’re taking from one to the other shifting. Greg Sticha: I can answer that question. Chanhassen City Council – October 28, 2019 25 Alan Nikolai: I’m just saying it’s more to the council here, that’s not crooked. That’s frankly slight of hand of how you’re, what you’re doing, you’re taxing is supposed to be for that and now you’re going to put it for something else which adds a concern by Bethany earlier about this dedicated oh yeah but it can’t, wait a minute. You’re seeing it here. You’re taking the library fund and putting it towards streets. That’s. Greg Sticha: Let me make one clarification on that particular item and this may or may not answer your question satisfactorily but the library levy I’m talking about is related to the bonds that were issued for that levy for that library built 20 years ago. So after 2021 the debt will be paid off. So you now have, it’s like no longer having a mortgage on your house so the City has the capacity and the total debt for that is $467,000 per year. So what the City Council has the option to do is use that mortgage if you will, that you no longer have to pay towards the library building, to use it for another purpose. And I don’t want to say it’s common that sometimes those levies get used for other purposes once those buildings are paid for but it is a good way to use those levies that don’t impact the taxpayers by okay, one year taking it off and then the next year asking for $200,000 for roads so that’s related to the mortgage payment if you will on the library no longer being in existence. Mayor Ryan: Mr. Nikolai I’d like, because I know you directed it at council as well. That is what is proposed for 2022 but as every year when we go through our budget process and we look at all the different levies that we’re you know evaluating for, as our overall levy conversation, that is what will be discussed. It’s part of this proposal but it is not money that has been shifted or moved or anything of that nature so like I, I think it’s very important to be clear because these are the levies that we evaluate as part of the budgeting process every year and this is what is proposed for 2022 but no council member, we have not said that this is how we are going to reallocate this debt so it’s proposed. It is not the confirmed solution and I think that’s important to clarify. Alan Nikolai: I understand it might be legal but is it ethical to the taxpayers? About transparency, I don’t think it’s ethical. At all to take from one fund and shifting it. I understand that it might be legal. There’s a big difference between ethical and legal. I guess I’m going to make a recommendation, I do not support the franchise fee. At all. Based on, I think frankly if you really want a tax increase do a referendum and let the voters pass it. Not the City Council. The voters. Do a straight referendum. If you got, have your case the voters will support it. If you don’t make your case they’re not going to support it. I think this, all the taxpayers should have a right to vote on it and they should vote on it basically one year from now at the primary elections. Put X amount of money. This is what we need to do. If it’s $3 million a year for X amount of years, but let the voters have a say on it. That’s my opinion. Thank you. Mayor Ryan: Great, thank you. Mr. Koch. Chanhassen City Council – October 28, 2019 26 Larry Koch: Larry Koch, 471 Bighorn Drive. Thank you. First of all I’ll reflect on the previous speaker. I too agree, and I expressed this when we had the, I guess maybe it was public hearing before at least 2 of you were, or 3 of you were elected to the council and I expressed my concern that this type of a tax is the most regressive tax you can possibly have. It has the most significant impact on low and fixed income people and that, I also have that concern. And there’s no good way of probably of raising taxes but I think that needs to be considered and I understand the whole goal here is so that the residential taxpayers pay a smaller piece of the pie that’s required to fix the streets and we want to go throw it onto the commercial properties. I mean that’s what we’re doing. We’re saying here’s the amount of dollars we need. We want to throw a bigger piece on the commercial properties than what we can do using the normal property taxes. Just so everybody knows that. You know we’re not hiding the ball which leads me to another comment by the previous speaker. I don’t like, and I don’t think there’s any citizen here that likes the idea of taking money that was approved for a library and all of a sudden shifting it to another purpose. And again whether you can do it or not I don’t think is the question. The question really is, is that good government and I say that’s really bad government because that leaves a bad taste in everybody’s mouth. Then you don’t get trust. If you don’t have trust how are you going to govern ultimately? Actually my biggest point before the prior speaker spoke was I don’t think we’re raising enough money. In my example Frontier Trail has been in a despicable condition for the 30 years that I’ve lived in Chanhassen and nothing has been done about it. It has patches on patches on patches and when I looked at the chart I didn’t see a place where Frontier Trail was going to be repaired. Certainly not in the first 5 years and if I missed it please correct me. The problem with Frontier Trail is not only it’s a bus route for example. A lot of, it’s a collector for a lot of people going onto 5 and ultimately into the cities. And another issue is that there’s a deficiency in the storm water pondage and draining on that, on the oldest portion which is at the bottom of the ravine and that has an impact on our water quality okay in Lotus Lake. And I think that we really need to look at really doing it right and actually spending more money. None of us like to pay taxes. I think that’s a given but when you have streets in that condition it doesn’t speak well for our city. Somebody drives on that, what do they think of our city? They go driving down our streets, which is another issue I have, we’ve got grass and weeds growing out of every one of the major boulevards. I grew up on a farm. We never had weeds growing out of roads or anything else like that and so we need to raise sufficient money so not only can we take care of our roads but we can maintain them and I’m very concerned what I observed this summer on 78th Street. Now I don’t know if that was all the city’s money or somebody else’s money threw in there but that was a simple sealcoat okay with gravel on it. On the street that I ride by almost every day for the past 5 years on my bicycle and I would have to say, since I’ve seen most of the streets at least in the middle part, that was probably the last road that needed to be done. It was in relatively good condition compared especially to Frontier Trail and especially I think it’s Conestoga which is only about 3 blocks away. So one we need to spend more money but I’m really concerned at how we determine which streets and roads we’re going to repair and I’ll leave you with the last point. I was in these chambers I believe some, it’s probably been almost 10 years ago when they redid Bighorn Drive all the way from Kerber. My street in front of my house was less than 15 years old. It needed a mill and overlay like I need another hole in my head. Now I finally convinced the council that if you want to go waste your money don’t Chanhassen City Council – October 28, 2019 27 spend my tax money wasting the money when there are other streets that need it so I have a grave concern about the decision process for deciding which streets and roads need to be fixed when. And in particular Frontier Trail needs to be fixed now and I don’t know if that’s a million dollar job or two million dollar job but it needs to be done now instead of throwing away a lot of money patching over patches. And so if you need to know we can do bonding. Go raise some money. Let’s go fix it right and pay for it if we have to over 20 years. At least we get it done right and we’re going to maintain these costs instead of having everything deteriorating more quickly and wasting money doing patches on patches. So I’m in favor of raising the money. There’s no good way to raise it but I think we need to do more because our city streets I think need more money and they need more repairs so I would like you to reconsider that and particularly the maintenance of our streets, whether it be from weed control, etcetera, to do it right. And I forgot one thing about the weed control. So the seal and overcoat. So what did they do? They go and squirt the oil over the top of the weeds thinking that oh that’s good enough right? Well you know what happens? The oil never gets down into the crack to seal it so now you’ve got a weed that is, sucks up moisture. It’s going to, the moisture’s going to go right down to the pavement. What happens when everything freezes right? It breaks up. That’s when you go down the street and you see where you have bituminous next to a concrete gutter and you see all these break out’s. That’s what happens when water gets in there and it freezes and it breaks it. So that also needs to be done so please raise the money. Please put money towards maintenance of these streets so that they’re done properly. Thank you. Mayor Ryan: Thank you Mr. Koch. Anybody else that would like to come forward? Ann Miller: Ann Miller, 6561 Fox Path. I agree with the previous two people on everything that they’ve said and also was, were toll roads, can roads be toll roads? Was that ever thought of? Or I’m serious about it. Especially for commercial, could there be a toll road in Chanhassen? Could it be Highway 5? I don’t know. It just seems that, I agree that we need to do it right instead of mill and overlay and my street Fox Path is an example. It was just done 2 years ago. I personally paid over $2,000 to have it done. It’s already breaking up. You can drive down and see it. That’s a perfect example. And also is Pleasant View Road eligible for MSA? Funds because I don’t see it listed anywhere. Todd Gerhardt: Yeah it connects to two major collector, 101 and then it goes over to Powers another collector so it’s on our MSA street collector program. Ann Miller: And at some of these junctures like for instance where Valley View Road runs into County Road 101 right now they’ve got all kinds of pink lines around what’s broken up. It looks like they’re going to patch that. I’m not sure is that, is 101 just a county road or is it, I think it’s called, you’ve changed it to Chanhassen haven’t you? Todd Gerhardt: Well it’s a county road south of Highway 5 down to Pioneer and then it becomes a state highway from Pioneer down to the lower whey or what is county road 61 and that is in the works of being turned back to the county so in 2020, this spring in 2020-2021 101 Chanhassen City Council – October 28, 2019 28 will be reconstructed south of Pioneer down to the roundabout and then that will become a county road. As you go north of Highway 5 up to Crosstown that is still a state highway but there may be agreements with the State that Hennepin County and Carver County may be maintaining that. Ann Miller: …where it’s 101, is that Carver County? Todd Gerhardt: No that’s Hennepin County. Ann Miller: That’s Hennepin County. Todd Gerhardt: Yep. Ann Miller: So as far as doing the roundabout where Pleasant View runs into 101, and the reason I’m bringing the roundabouts up I think we need more roundabouts in Chanhassen and I’m just thinking of slowing traffic down as it enters one area and I don’t know Minnewashta Parkway when I hear about that I’m thinking well why wouldn’t you have roundabouts but the other thing is what about delinquencies if people decided not to pay their franchise fee. Todd Gerhardt: Well if you do not pay your electric and gas bill they will shut your electric and gas bill off. Ann Miller: Okay because it’s. Todd Gerhardt: Or shut your electricity off. Not your bill but your, they’ll keep sending you a bill and there will be charges on there plus fees. Ann Miller: Okay. Well and I also agree with Bethany that I’m afraid that, about number 2. The additional funding for financing the City’s share only. About what other ways you would put our money so I am against it right now thank you. Mayor Ryan: Thank you. Todd Gerhardt: Mayor, council. This pre-dates you but we did look at toll road for Highway 212 as a part of funding for that and there was overwhelming no support for a toll road for 212. Or anywhere really in Minnesota so people will use the sane lanes and pay a fee for that but they want to have options and there was no support for a toll road. Mayor Ryan: Perfect and Mr. Gerhardt, well I’ll save my question for later. Anybody else want to come forward? Alright with nobody else coming forward I will close the public hearing and return it to council for questions or comments. Councilman McDonald. Chanhassen City Council – October 28, 2019 29 Councilman McDonald: Well I guess I’ll start. You know we’ve been doing this for almost 3 years trying to decide how we’re going to do this. Everything that you brought forward tonight we have discussed. We looked at bonding. We looked at a number of different ways to do this. We looked at how do we not have too big of an impact on the residents. How do we do it fairly. There is no way to come up with a way to do it fairly. The next big thing you have to decide is do you want your roads fixed or not? We went through all that. How do we determine what roads need to be fixed. Do we really need to do all these the way that staff had laid them out. This past winter shows that you have a bad winter and all of a sudden the roads go to hell in a handbasket. It’s as simple as that so then at that point you’ve deteriorated the roads even more. You drive up the cost even more and the problem just gets worst and worst. You talk about bonding. We looked at bonding and in about 10 to 15 years all of a sudden the debt service load gets even bigger than this. That’s not a good answer either. All I can tell you is we have looked at everything and the councils have gone through. We’ve butted heads over all of this. We’ve tried to find ways to again not impact people. I’m in favor of this franchise fee because it hits everybody in the city, not just the homeowners and the taxpayers. It goes after non-profits. It goes after anybody that owns property in the city and I just have this belief that everybody should contribute to the roads in the city and this is the only way to do it. Otherwise with property taxes if you’re a non exempt property you don’t pay property taxes. So this is the only way to make sure everybody pays for the roads. Again looking at how important are the roads? It’s the number one thing. Mr. Koch brings up the whole thing about his street. Your’s is not the only street I hear these things about. As soon as a road gets to a point where there’s the first little crack or first little pavement our public works department hears about it and everybody wants their street fixed now. In order to do that it takes money. What we’ve tried to put together I think is at least a plan for how do we address all the roads within the city. Is it perfect? No but again at this point it’s a proposed plan and I think that as we’ve said each year City Council is going to have to go over the pavement management program and look at how much are we going to spend and where are we going to spend it and each year we always demand of staff yeah go out, look at the roads. Tell us which ones need to be fixed. Why do they need to be fixed so that’s on each future council. I think this council has done it’s job as far as looking at the problem and we’ve come to the solution that there’s no easy way to fix it. It’s as simple as that. There is just no easy way to fix it. One of the other things I wanted to address is okay the disparity. Again I don’t know how to solve that. $5 does not seem that bad on a residential home and we looked at all kinds of numbers to make this work. Is it too much for someone on a fixed income? It could be. I don’t know. Is it too much for someone with a million dollar house? It certainly could be because they could be living beyond their means. Any number you pick is going to be arbitrary. It is going to depend on the individual that is getting hit with this fee as to whether or not it’s fair or unfair so I don’t know what to do about that. Again what it comes down to is we’ve got to fix roads. What we’ve come up with is a plan to do that. You asked about a referendum. That’s not the way you fund roads. That really isn’t the way you do it. You may do it for parks and you may do it for other improvements you want to make with the city but roads are taken care of by pavement management funds. They’re taken care of through your taxes. Every city in this state does that. I don’t know of anybody that goes out and does bonding to do the normal pavement management. If I’m wrong please correct me but that’s one Chanhassen City Council – October 28, 2019 30 of the constraints that we’ve got to deal with. Otherwise what we’re going to be holding levies every 2 to 3 years? That’s not realistic. So I hear what everybody says and like I say over the past 3 years we have looked at everything you have brought up and again the conclusion I come to and I can’t speak for the rest of the council is, this is not an easy problem to solve. It’s as simple as that but the most important thing what we have to agree upon roads need to be fixed and if we agree upon that then we’ve got to find a way to do it and this is our proposal to do it. It’s the most fair I think of all the proposals we looked at. It’s not perfect but it accomplishes what the residents tell us they want and what they want is they want roads they can drive on. The want roads that are in good repair and they want roads that they can depend upon. This is the only way I know of to do it and I haven’t heard any other suggestions from anybody else in all the 3 years of another way to do this that really meets the requirements. I’m sorry for that. You know this is, this is not an easy thing to come up with but this is the best solution to really what’s a very bad problem and that’s the fact our roads deteriorate so that’s why I’m in favor of it. I would support the franchise fee and all the other amendments that go with it and again I do that because over the past 3 years or so we have beat this thing up all over the place and there is no easy answer. This is the best solution and that’s why I’m in favor of it. Thank you. Mayor Ryan: Thank you Councilman McDonald. Councilwoman Tjornhom. Councilwoman Tjornhom: Councilman McDonald I have to say I agree with you. The roads need to be fixed and I think that you kind of laid and established out the whole process that we’ve been through for at least 3 years looking at the budget. Looking at the real numbers and seeing the potential problems we’re going to have. The bumps in the road so to speak in the following years so I don’t disagree that we need to fix our roads. That we need to have a plan to fix our roads and we need to have a funding source to fix our roads. What I do disagree, or what I do not feel comfortable with is the way we’re going about it. The process. Yes it’s true a lot of these cities that have these fees they do use the roads, or these fees for fixing roads. For road improvement projects but there’s no guarantee for that and that’s what I can’t get past. The fact that we could say yes. We could tell everybody they could see these slides and they could see that yes the City is going to use these funds. The $1.7 million dollars to fix roads. What I’m concerned about though is that alright so in 3 years from now new faces are sitting here tonight, or in 3 years and they decide they’d like to do something different so they’ll take those funds. They could take this $1.7 million dollars and use it towards a new project and then levy again for roads and so I think there’s a potential to use this as a stepping stone for other projects in the future and so that’s why I can’t support this. If there is a definite way where I could just firmly agree and say yes we need to fix our roads. This is a great way to do it because I do agree that it is, nothing’s fair so it is probably the most fair process because we are, we’re reaching all those people in our city that have to pay utility bill and so it’s not just people. It’s not just businesses. It is non-profits and so then it is more fair because those non-profits and those businesses they do bring in people. They bring in the businesses bring in trucks. The non-profits bring in a lot of people so I think that it’s the most equitable way of funding our roads. I just don’t think it’s the most sustainable way because I’m afraid that at some point, like I said these funds will be Chanhassen City Council – October 28, 2019 31 allocated for other projects and then people will be levied even more for roads so I cannot support it. Mayor Ryan: Thank you Councilwoman. Councilman McDonald. I mean I’m sorry, Campion. Councilman Campion: Alright so I do agree with nearly everything that Councilman McDonald said. I think that he said it very well. This is a very difficult problem that we have wrestled with for the past few years. We’ve had heated debates on it. We’ve tried to get creative and think outside the box. Come up with new ways to solve it. It’s a problem that just gets worst year after year. If we do nothing the problem gets worst next year for the council to try to address. If it goes 2 years out it gets even bigger. I think that this is our job as councilmembers is to deal with difficult problems like this and given all the facts and doing our homework I believe that this is the least bad alternative to solve and address this problem and I believe that we’ll be held accountable for this as well, as we should be. If a future council misappropriates these funds and uses them in ways that the residents don’t approve of then they do have opportunity to weigh in at the next election. And yeah that’s it. I do support this and I plan to vote for it. Mayor Ryan: Thank you Councilman Campion. I’ll wrap up here with my comments before we turn over to a motion. I too don’t take this lightly. I think this is a really challenging decision. I voted against it last year because I wasn’t comfortable with the information. I wasn’t comfortable with the plan that was laid out. I just felt that there were missing pieces in order to move forward with it. I know we’ve talked about that, that this has been discussed for the last 2 to 3 years. I would argue that this has been a conversation for probably closer to 15 years of how are we going to continue to fund the roads. I mean when we’re looking at our fund balance and we are told that we are essentially going to be out of funding for our roads in 2021 and that would be with the decrease of going every other year, how are we going to pay for our roads? I mean this has been a long term problem, concern that has needed addressing and it hasn’t been addressed and by putting surpluses into the pavement management fund or taking when projects come in under budget and putting it back into the pavement management program, that is not a long term plan for funding our roads and we need to make these tough decisions which aren’t easy because of fairness and equity and the challenge it is for every taxpayer whether you’re on a fixed income or you live in a million dollar home these are taxes and you have elected your city officials to do right by you and spend your tax dollars accordingly and that is why we had asked, council had asked for a deeper dive and more specificity around what roads are going to be done. What is going to look like. We need to address potholes. You know is a mill and overlay going to be better than a reconstruction and so the engineering department really took a deep dive into this entire process to come back to council and say, here is our long term plan. Not only for this year but well into the future and that is something really important when you’re talking about allocating funds for now and into the future that there is a plan. You know as Chanhassen our motto is you know a community for life. Well we have to be preparing for that and that’s part of these tough decisions is how are going to plan, prepare and fund projects that we have. We, to your point Mr. Koch when you said look at bonding. That was one of the very first things that we did at the beginning of the year and we had multiple meetings on what would bonding do to Chanhassen City Council – October 28, 2019 32 the City and the City takes great pride in having a AAA bond rating and really a strong financial position for you know for the strength of our city and when we evaluated whether or not that was an option, it was not an option that this council believed in because it puts more hardship on the City then need be and so we wanted to look at other options. As Councilman McDonald said we’ve gone through every number. We’ve gone through every percentage in terms of how can we divvy this up to make sure that it is most fair and this was the hard solution but the best solution that we as council could come up with. I know there was concern, I share concerns about, as Councilwoman Tjornhom says about how are these funds going to be allocated. But to Councilman Campion’s point that’s why you do your job in electing city officials to make sure that they are utilizing the taxes correctly and whether the franchise fee could be changed by a future council, well every fund that we have in our budget those monies can be around, moved around if there is not oversight by the council members and that is our job and that is why we spend months upon months reviewing the budgets. This is not something that happens overnight. This is not something that all of a sudden in December when we set the levy it just, we just come upon it. These are long term discussions that we as a council have with staff. We challenge them to get us better answers. Different answers so that when we have to actually take a vote we are comfortable with the vote that we are putting forward. So you know when I look at this I look at the roads. They need to be sustained, maintained and improved and those were the 3 words that I kept coming up with is because that is the long term plan for what I think that our community needs with the expectations of residents in this city with the services that Chanhassen provides and part of that is infrastructure and maintaining that and that is, you know that is the responsibility of this council as well as future councils so it is a very difficult decision to implement a franchise fee because it is not done in the history of this city and so I know I certainly don’t come by that lightly but it is something when I look at our fund balance we don’t have a choice. We have been put in this situation and we need to do something about it and so therefore I will be supporting this franchise fee. With that is there anybody that would like to make a motion? Councilman McDonald: Mayor? Mayor Ryan: Yeah. Councilman McDonald: I’ll make the motion. Mayor Ryan: Councilman McDonald. Councilman McDonald: I would propose the City Council adopts the attached franchise agreement ordinances and franchise fee ordinances. Mayor Ryan: We have a valid motion. Is there a second? Councilman Campion: Second. Chanhassen City Council – October 28, 2019 33 Mayor Ryan: With a valid motion and a second, any further comments? Councilman McDonald moved, Councilman Campion seconded that the City Council adopts the attached franchise agreement ordinances and franchise fee ordinances. All voted in favor, except Councilwoman Tjornhom who opposed, and the motion carried with a vote of 3 to 1. Mayor Ryan: That motion carries 3-1. PUBLIC HEARING: CERTIFICATION OF DELINQUENT SEWER AND WATER ACCOUNTS TO THE COUNTY AUDITOR. Greg Sticha: Good evening Mayor and council. On an annual basis the City Council considers the certification of delinquent utility bills to the county auditor. Under State Statute this is allowed, I believe it is Section. Roger can you help me with the section number? Roger Knutson: 444. Greg Sticha: 444. These accounts have been delinquent at a minimum of 3 months and in some cases have been delinquent for over a year. The attached list shows the number of accounts as well as the dollar value of those delinquent accounts. It’s almost identical as to last year and the year before so there’s no real change in the amount of delinquent accounts as compared to previous years. So with that and without any further discussion I would open, ask the council to open a public hearing to take any comments from any potential delinquent account holders that might be here this evening and then after the public hearing ask the council to certify the delinquent list to Carver County. Mayor Ryan: Okay I hereby open the public hearing. Please step forward and state your name and address for the record. If nobody here I close the public hearing and return it for a motion. Councilman Campion: I’ll make a motion. Mayor Ryan: Yes. Councilman Campion: Alright I make a motion that the City Council adopts the resolution certifying delinquent utility accounts to the county auditor. Mayor Ryan: We have a valid motion. Is there a second? Councilman McDonald: Second. Mayor Ryan: With a valid motion and second all those in favor please signify by saying aye. Chanhassen City Council – October 28, 2019 34 Resolution #2019-52: Councilman Campion moved, Councilman McDonald seconded that the City Council adopts a resolution certifying delinquent utility accounts to the County Auditor. All voted in favor and the motion carried unanimously with a vote of 4 to 0. Mayor Ryan: That motion carries 4-0. COUNCIL PRESENTATIONS. Mayor Ryan: With no new business are there any council presentations tonight? Councilman McDonald: Madam Mayor if I could. Mayor Ryan: Yes. Councilman McDonald: Last council meeting I was not here. I was actually in New York City. As part of my duties with the City Council I represent the City of Chanhassen with Southwest Transit and what I was in New York for was the Transit, well the Transit, the National Transit Association meetings where they do education about public transit. Where the trends are as far as public transit. Where things are going. Where they would like things to go and some of the things I learned from all of this is that public transit has thoroughly embraced the idea of electric public transit and they’re trying to put together a number of programs in a number of cities where that can become a reality. There’s been a lot of pressure on manufacturers, bus manufacturers and battery manufacturers to make an electric bus and I think one of the things that happened in Minneapolis, Minneapolis tried to electrify one of their lines and it was a big failure and they had to pull the buses and part of the problem was they don’t have the infrastructure to charge the buses. It takes a lot of electricity to charge a bus and that’s something that all of these cities, and there was a big emphasis on the west coast and the east coast where a lot of this innovation is coming from but they’re looking for solutions to this and I think what you’re going to see is the things that cities, there were also city leaders there. We just went through the whole tonight about a franchise fee. In the larger cities across the U.S. what they’re now starting to look at is they’re going to start implementing congestion taxes and New York City is supposed to roll their’s out either this month or next month but like London, England they’re going to look at certain areas and are going to try to keep cars out of those areas and they’re going to do that by taxing them and that includes taxi cabs, anything with an internal combustion engine. So there is a real move throughout the nation to go with electric buses and all these things. Southwest Transit, we’ve been looking at this for golly I think the first one I saw was almost 5 years ago and at that point you were lucky if they could go 20 miles and the problem is most of the routes with Southwest are 20 plus miles so also you needed large charging stations and infrastructure. While they’ve gotten a lot better it’s not quite as bad as what it was but the biggest problem they have is range. They still are around 20 to 25 miles. They haven’t pushed that much higher than that. Charging is easier than what it was even though Metro Transit couldn’t charge their buses. And I think that again that’s the trend of what everybody is going toward is that they want to see public transportation instead of being done by Chanhassen City Council – October 28, 2019 35 internal combustion engines being done by electric vehicles and you’re going to see a lot of policies. Minneapolis was there and they are also looking at this whole thing about congestion in the downtown area. They’re looking at ways to again encourage people to take public transit. To ride scooters. This was the first time there was a large discussion about scooters. Every city has got it’s horror stories about these E-Scooters and there’s a lot of talk about that they need to regulate them and so that was part of what this conference looked at was how can we do a unified approach to this so that at least the scooter manufacturers or the owners of the scooters aren’t trying to meet regulations in 20 different cities that they just can’t meet. The cost at that point gets to be too high so I guess my time away from here was well worth it at least as far as looking at public transit and how that will eventually affect us in this area so that’s what I was doing was learning even more about public transit. Mayor Ryan: Great. Great update, thank you. Councilman McDonald: You’re welcome. Mayor Ryan: Alright no other council presentations but thank you Councilman McDonald. ADMINISTRATIVE PRESENTATIONS. None. CORRESPONDENCE DISCUSSION. None. Councilwoman Tjornhom moved, Councilman McDonald seconded to adjourn the meeting. All voted in favor and the motion carried unanimously with a vote of 4 to 0. The City Council meeting was adjourned at 9:20 p.m. Submitted by Todd Gerhardt City Manager Prepared by Nann Opheim CHANHASSEN CITY COUNCIL WORK SESSION OCTOBER 28, 2019 Mayor Ryan called an Executive Session of the City Council to order at 5:30 p.m. The regular work session was called to order at 6:50 p.m. COUNCIL MEMBERS PRESENT: Mayor Ryan, Councilwoman Tjornhom, Councilman McDonald, and Councilman Campion COUNCIL MEMBERS ABSENT: Councilwoman Coleman STAFF PRESENT: Todd Gerhardt, Jake Foster, Bruce Loney, Greg Sticha, Jon Horn, Sonja H. and Bob L. EXECUTIVE DISCUSSION The City Council met in Executive Session. The meeting will be closed as permitted by Minnesota Statutes Section 13D.05 for attorney-client privileged communications related to last written offers for CSAH 101 right-of-way acquisition. PAVEMENT MANAGEMENT FUNDING DISCUSSION – ANALYSIS OF ANNUAL STREET PROGRAM FUNDING. Greg Sticha reviewed additional information included in the staff presentation for the pavement management fund including the 5 year plan for street projects, options for funding if nothing is done, new funding including a $3.6 million increase using all revenue streams, and explained the action being requested of the City Council at their regular meeting. Mayor Ryan adjourned the work session at 6:58 p.m. Submitted by Todd Gerhardt City Manager Prepared by Nann Opheim CITY COUNCIL STAFF REPORT Tuesday, November 12, 2019 Subject Receive Planning Commission Minutes dated October 15, 2019 Section CONSENT AGENDA Item No: D.2. Prepared By Nann Opheim, City Recorder File No: PROPOSED MOTION “The City Council receives the Planning Commission minutes dated October 15, 2019.” Approval requires a Simple Majority Vote of members present. ATTACHMENTS: Summary Minutes Verbatim Minutes CHANHASSEN PLANNING COMMISSION REGULAR MEETING SUMMARY MINUTES OCTOBER 15, 2019 Chairman Weick called the meeting to order at 7:00 p.m. MEMBERS PRESENT: Steve Weick, Mark Undestad, John Tietz, and Doug Reeder MEMBERS ABSENT: Mark Randall, Michael McGonagill, and Laura Skistad STAFF PRESENT: Kate Aanenson, Community Development Director; and MacKenzie Walters, Associate Planner PUBLIC HEARING: CONSIDER A REQUEST FOR A REAR YARD SETBACK VARIANCE TO CONSTRUCT A COVERED PORCH AND WALKWAY AT 832 WOODHILL DRIVE. MacKenzie Walters presented the staff report on this item. The applicant, Noreen Hoft discussed the key criteria of harmony, adverse impact, practical difficulty and economics as it relates to their variance request. She showed a short video presented by Dr. Martha Nance, a Neurologist with the Huntington’s Disease Center of Excellence at HCMC, describing the progression of her husband’s disease. Chairman Weick asked for clarification on the alternatives being presented before opening the public hearing. Jay Aos with AOS Construction explained why the proposed location for the screened in porch is the best location on the property. Brigid Klaysmat, 800 Woodhill Drive asked that the Planning Commission approve the variance to provide the Hoft’s with a screened porch to enjoy being outside. Shelby Manion, 825 Lone Eagle voiced her support for the variance as the best alternative for this piece of property. Chairman Weick closed the public hearing. After comments from commissioners the following motion was made. Tietz moved, Undestad seconded that the Chanhassen Board of Appeals and Adjustments approves a 6 foot rear setback variance for the construction of a screened porch subject to the following conditions, and adopts the attached Findings of Fact and Decision: 1. The applicant must apply for and receive a building permit. 2. Provide an updated survey with permit submittals that illustrates all existing utilities on site and is in accordance with City Code of Ordinances Sec. 7-19. 3. A 10 foot wide utility easement shall be recorded in perpetuity with the property for the maintenance and repair of the storm sewer pipe and manhole located on the subject property. This easement shall extend to the southern property line in order to access the storm sewer pipe. Planning Commission Summary – October 15, 2019 2 All voted in favor and the motion carried unanimously with a vote of 4 to 0. APPROVAL OF MINUTES. Commissioner Undestad noted the verbatim and summary Minutes of the Planning Commission meeting dated October 1, 2019 as presented. COMMISSION PRESENTATIONS. None. ADMINISTRATIVE PRESENTATIONS. Kate Aanenson provided updates on upcoming meetings agenda items, and updates on projects around town. Undestad moved, Reeder seconded to adjourn the meeting. All voted in favor and the motion carried unanimously with a vote of 4 to 0. The Planning Commission meeting was adjourned at 7:55 p.m. Submitted by Kate Aanenson Community Development Director Prepared by Nann Opheim CHANHASSEN PLANNING COMMISSION REGULAR MEETING OCTOBER 15, 2019 Chairman Weick called the meeting to order at 7:00 p.m. MEMBERS PRESENT: Steve Weick, Mark Undestad, John Tietz, and Doug Reeder MEMBERS ABSENT: Mark Randall, Michael McGonagill, and Laura Skistad STAFF PRESENT: Kate Aanenson, Community Development Director; and MacKenzie Walters, Associate Planner PUBLIC HEARING: CONSIDER A REQUEST FOR A REAR YARD SETBACK VARIANCE TO CONSTRUCT A COVERED PORCH AND WALKWAY AT 832 WOODHILL DRIVE. Weick: This is Planning Case 2019-16 and it will be in front of City Council November 12, 2019. Walters: If appealed. Weick: If appealed. Thank you. MacKenzie I will let you begin, thank you. Walters: Thank you. So as mentioned this is Planning Case 2019-16. It is a request for a 6 foot rear setback variance for a property located at 832 Woodhill Drive and it’s for the construction of a screened porch and walkway. The property is located in the RSF, Residential Single Family zoning district. This district has a minimum required lot size of 15,000 square feet, has 30 foot front and rear setbacks, 10 foot side yard setbacks, allows 30 percent lot cover, with a maximum of 25 percent being impervious coverage. The site, oops I did not change…from last time. My apologies but the picture is right. So this is 832 Woodhill. Not 690 Carver Beach Road. The area for this site is 22,000 square feet. It has 100 foot lot depth. 120 foot lot width. Staff estimated it at about 13.2 percent lot cover so well under the 25 percent impervious limit. The property currently meets all setbacks. The rear yard setback is shown here in red and the applicant’s proposed screen porch and walkway is in blue and open walkway is in green. The open walkway would be allowed under the zoning code and about half of the screen porch and a couple feet of the screened walkway would be subject to the variance. So the applicant is proposing adding a screen porch and walkway off the rear of the home. Again the red line is the 30 foot rear setback so you can see in blue where it would be encroaching into the required setback. The applicant’s justification for the variance request is that they did not choose the configuration of the home or the placement on the lot. That the lot does not meet the required 125 foot lot depth for the residential single family district. The proposed location would be screened from neighboring properties by existing trees and landscaping. They have noted that Chanhassen Planning Commission – October 15, 2019 2 alternative configurations and placements are unviable due to the husband’s limited mobility and the location of living room windows and other grading on the site. When staff looked over the request staff believes there are alternative locations that a very similar or identical structure could be placed that meets city code. Open decks for example would be permitted as proposed without any variance. In terms of some of some of the alternatives, Alternative A here comes off of a door they showed here. This could be an entirely enclosed and screened porch again without a variance being required. An open walkway could be utilized here to access a 12 by 12 screen porch without requiring a variance. Similar to the one in red. If the commission were to feel that a screen walkway is needed that can be accommodated with a 2 ½ foot rear yard variance if they use a different positioning for the screen porch. Staff does agree that the lot is under the district’s minimum lot depth. However we feel that the oversized lot width accommodates that and provides a sufficient building pad to meet code. Because staff believes there is an ability to construct a proposed improvement or a similar feature without a variance staff must recommend denial of the requested variance. If you have any questions I’d be happy to take them at this time. Weick: Anyone have questions for MacKenzie? Reeder: The two lots behind this house, do you have that? Yeah. Walters: I think that’s the best picture I have in here of them. Reeder: Is that a house that you’re pointing at or is that a garage? Walters: I believe this is the garage. This is the garage. This would be the house on the property to the northeast and this would be the residence on the property to the northwest. Reeder: Okay. And those houses appear to be very much up to the street level as opposed to, they have a huge back yard is that accurate? Walters: Yeah looking at the houses on the block it looks like non-conforming front yard setbacks are much more typical than non-conforming rear yard setbacks. Things tend to be placed forward on the lot rather than pushed back. Reeder: Okay. Weick: MacKenzie I do have a question for you. Is the covered, and I can’t remember if you mentioned this or not but is the covered walkway and deck considered open or closed? Walters: They are considered closed. If there’s a rough in screen it’s not considered to be an open deck or porch so then it’s not entitled to the 5 foot encroachment into the rear yard. Weick: Okay. Even if it’s not screened? A roof would be. Chanhassen Planning Commission – October 15, 2019 3 Walters: Yeah if there’s a roof we’d have to consider it a closed. Weick: Okay. That’s all I had. Any questions to my left? Thank you MacKenzie. At this time I would invite the applicant to make a presentation. Noreen Hoft: Thank you very much Steve. Weick: You bet, Noreen Hoft: And hello John, Mark, Doug, Kate and MacKenzie, thank you very much. So my name is Noreen Hoft. I’m the homeowner. Weick: Can you speak into the microphone because it gets recorded. Noreen Hoft: …so I’m new at this. I’m not used to making presentations in conference rooms not to be recorded for public record. So I’m Noreen Hoft, the homeowner at 832 Woodhill Drive and I’m here to kind of embellish a little bit some of the items that I included in our written justification for the variance and to offer some background information and detail about why we really want this. So let me just suggest that the intent for this presentation is to really further address those key criteria, harmony and adverse impact. Practical difficulty and economics. Kindly enough Bob Generous in my pre-meeting with him pointed out that those are the ones I should really focus when I presented to this commission tonight. So what I want to do is first introduce the stakeholders who are in the room who are the public who are attending this evening. I’ll address those key criteria and then answer any final questions that you any of the commission members might have. Does that sound okay? Weick: Yes. Noreen Hoft: Okay. So hopefully by the end of our time together tonight you’ll feel strongly that the project and it’s associated variances or variance request not only meet the criteria but also enhances a Chan vision which I see was in the beginning of your presentation as well. That Chanhassen is a community for life. Providing for today and planning for tomorrow and in our case it’s the life that my husband and I have been living for almost 20 years now in Chanhassen and hope to have for at least another 10 to 15 depending upon the progression of his disease. So that’s what I’m hoping for. We’ll see if I get there. Now did anybody notice this year that there were more insects than usual? Anybody? Mosquitoes. Gnats. Bees. Yes, yes people on Woodhill Drive did in this wet year so you know certainly that recent condition has sparked the interest of having a screened area and I just say that because I thought I might have a little audience engagement and they did. So let’s talk about the adverse impact. Stakeholders in the room are two adjacent property owners. Doug you asked about the family behind us. In the room we have Shelby Manion. Kevin and Shelby have been living in that home since 1990. It’s 825 Lone Eagle and we share together 140 feet of our back lot line so they have 70 percent. The Chanhassen Planning Commission – October 15, 2019 4 other neighbor up the hill has 30 percent. Also represented tonight is a stakeholder is Brigid Klaysmat. Steve and Brigid have been living on Woodhill Drive since 1994. Is that when you moved in? Can’t remember. Yes ’94 but have been in their current home since 2003. They’re at 800 Woodhill Drive and they share 100 feet of our side lot line and that’s 100 percent of that based on the way that area of Carver Beach was plotted and the property line we share runs south to north. So when the public called for by the Chair then Brigid and Shelby can answer questions and/or address the group. Also in the room as a stakeholder is the contractor that we have chosen. Jay Aos. Aos Construction is in Burnsville, Minnesota. He’s a general contractor who has over 15 years experience. Two full time master carpenters in addition to him and he has outside expert resources that he can tap into when needed like a structural engineer but what I really like most about Jay is his values. Integrity. Quality. Communications. He has a strong Christian background that I think that helps those of us who deal with him in a customer basis to feel good about the work that he will do and that they will work together. So those are the stakeholders in the room. So MacKenzie very kindly talked about the proposed placement that we have submitted and what Bob Generous had originally estimated was a 6 foot variance and a 5 foot variance but MacKenzie I think has given a much clearer detail when he said the actual 30 foot setback line through the diagrams but wondering if there was any questions about that. Weick: And we’ll, the way we would normally is we’ll let you make a presentation. We’ll make notes of our questions and we’ll ask them at that time. It just, it will make it flow a little. Noreen Hoft: Little easier for you guys? Weick: Yep. Noreen Hoft: Okay great, thanks. So MacKenzie already showed you this picture. What you can’t see very well are the pencil marks that I did at the top of this particular diagram with Shelby’s home and her garage and then the garage and the home next door which Doug was referring to. It’s like where are those houses placed and that’s our best rough, rough estimate. No measurements. No yeah, no survey. That’s just about where they are. Okay so that was my original version of the design diagram. And you might be wondering why didn’t I actually have an architectural rendering or the design from Jay, the builder and that’s because until I get your approval, hopefully we’ll do that today, then I didn’t want him to invest his time nor did I want to invest any of our funds beyond this actual hearing and our request for the variance. Okay so there’s my house. I don’t know if any of you have had a chance to be on the property. This is a downhill view so we’re looking from the east to the west and you can see how the, there’s a setback of sorts with the sliding glass doors in our dining room that really was put there by the original family who designed this home and began to build it for the purposes of having a deck. And then the side of the house you can see where I think what proposal was that MacKenzie? Was it letter, it was red. Walters: I believe it was Alternative C. Chanhassen Planning Commission – October 15, 2019 5 Noreen Hoft: Alternative C so you can see what that would look like on the side of the house so just an idea of what the home looks like in it’s current condition. So here’s again a series of pictures for you. So the view on the left is, if you’re standing looking at my kitchen window and then you just stay in place and turn 180 degrees and look at Shelby’s property, the Manion’s property…that’s the view you see. So from my kitchen window I see their garage. From the sliding glass doors I still see their garage. And then from the other end, it’s hard to see. That makes me go cross eyed but you’ll see that we’re beginning to have a view from that far wall, which is the east, northeast wall to the space between the garage and the house. So I offer those pictures to say that in your proposed placement of this porch that is screened and roofed, it’s all facing a garage and an open space on their lot. That’s just kind of a FYI. So my request is for the north placement and I didn’t know about the placement by the garage which is in green I believe and that was A, B or C? Walters: That was A. Noreen Hoft: A okay so I didn’t know that one. So this is, give me a letter please MacKenzie. Walters: This would be B. Noreen Hoft: B, okay. Alright. From B you can see that we have, see the two trees on the right. I would have to take those down to be able to do the actual deck off of the face of the house that is east. That’s another view of it and downhill there from the little bridge, and as you can see the sunshine in the distance that’s the Klaysmat’s house. Okay so just some pictures. Any of those you want to see again or have a need to take a look at? Does it give you a picture? At least in your mind of what we’re talking about. Okay, great. Alright so let’s move onto the criteria. So practical difficulties. In complying with the zoning ordinance that means that the property owner proposes to use the property in a reasonable manner not permitted by this chapter so in my effort to submit the application to present I’m trying to be reasonable. We did, and already MacKenzie did a great job of presenting that you know we want an outdoor space that’s accessible to my disabled spouse and enjoyable for both of us and my little joke about the bugs that fell flat was really that I want to be outside in a screened in area. The older I get the more I hate the bugs. The slope of our property is also an issue. The further downhill you go you know the more water runoff. The more soil erosion. The closer we get to the sewer line. All those good things and MacKenzie again very well presented it. We didn’t build the house. We bought it when it was finished but we are the first occupants so we didn’t choose it’s shape, it’s location or anything of that nature. So Huntington’s Disease which is the condition that my husband has. You know you might be wondering is this appeal for us to have easier access for him which would be, he’s now using a walker. A wheeled walker when he’s out. He can get around a little bit in the house but he’s going to be wheelchair bound and so to get onto the deck, the one that we’ve proposed, he would be able to wheel himself or I would wheel him out the sliding glass door to that walkway. Our hope is that it would be screened and roofed so that there’s not a lot of bugs. We need the door open as long as it takes to get the wheelchair out and turn him around. So you also might be wondering you know why would we approve this for you when the next resident or Chanhassen Planning Commission – October 15, 2019 6 homeowner might not have physical difficulty and I think that that’s a you know 50/50 shot. We don’t know who will own the house next so if you approve the screened porch areas then it would be accessible for them. So I would remiss if I didn’t take 5 minutes and ask you to bear with me for 5 minutes to have you see a short video on You Tube and the neurologist who’s presenting is Dr. Martha Nance and she is my husband’s Neurologist. She heads the Huntington’s Disease Society of America. She is a physician who runs the Huntington’s Disease Center of Excellence at HCMC and she very easily and quickly just kind of describes what this disease is about. A short video was shown at this point in the meeting. Noreen Hoft: Thank you MacKenzie and thank you for listening. Sorry that the buffering didn’t allow you to see her actually speaking. So my husband is between Stages 3 and 4. His symptoms first showed up in 2009 so we’re about 10 years into the symptoms and she said 15 to 20 years is the usual cycle. With our eldercare attorney we have decided we’re going out feet first in Chanhassen. That’s where we’re going to be. We’re going to be in that house as long as we possibly can and I’m prepared to be the caregiver at home for my husband as long as I possibly can. So having this screened porch area will be for us something that will help us when we’re homebound to give us some outdoor space where he can go and I can go. I can get away. My little get away in the back yard as well. So I know MacKenzie had said some people might exaggerate, he mentioned to me when we had a brief conversation, some people might try to really stretch the truth of the disease or condition and that’s why I wanted to just have that 5 minutes of You Tube for you to hear from the expert about what it’s about. So practical difficulties. So either the garage placement or downhill on the east side, you know I mentioned the slope of our property. We have several trees we’d have to remove. We’re concerned about erosion. If they do a free standing construction Jay will speak to the expense of that and then we’re getting down into the storm sewer area. You know it used to be a creek back there. Jerry Johnson is our neighbor to the west. He was 2 months old when he moved to that property 83 years ago. Do you know Jerry? He’s a good guy. He’s a good guy. So you know he’ll tell us all kinds of history. There was a pond up here. There was a stream over here and you know so knows every, probably every inch of our immediate neighborhood. So we even have addressed that with a dry creek bed on our property as well to try to move that water along. So there are both practical difficulties and economic impact from those items I have on this supplemental information about the slope of our property. So here is a picture of the sewer. Do you see the sewer cap? Or what you call a manhole that’s in our back yard and to the left of it you can see our dry stream bed. And it would be almost encroaching on that with something on the east side. Now this is more from a harmony and adverse impact perspective. And this is really an opinion, not a matter of fact but I think that that screened porch out there in the middle of the woods will stick out like a sore thumb. If it’s tucked behind on the north side you know it’s tucked away. It will encroach on the wooded environment enjoyed by both the Manion’s as well as the Klaysmat’s and us. It also may block the Manion’s view of the wooded environment so I think that the north placement is much better than the east and the garage placement is not good for my husband. So this is a picture from the Manion’s deck to our property and you can see it’s pretty Chanhassen Planning Commission – October 15, 2019 7 wooded and so if we place that as proposed then that would be their view. Those trees of course will grow up but there’s plenty of them to make it private for us and you know for Shelby and Kevin, private for them. Okay so again harmony and adverse impact. For the neighbors who are here, 800 Woodhill and 825 Lone Eagle, others in the immediate surroundings I did not ask to come tonight but they would have been willing. The neighbor who is west of Shelby who is 855 Lone Eagle, Jerry at 6941 Nez Perce. 843 Woodhill Drive which has a member of the sheriff’s department, Don Ennenga and 829 Woodhill Drive which is the Mason’s former house, now occupied by a young family. So I didn’t get emails as MacKenzie had suggested but those folks are all in favor and the other neighbors are also here who can confirm and validate that that’s what those people have said to them verbally but if you need additional things in writing we’ll be happy to provide that. Okay so, that’s basically the supplemental information and my appeal to you for the variance to get approved and I just want to open it up for questions from the commission to me and we’ll go from there. Weick: Well thank you and I, sometimes I say I don’t speak on behalf of all the commissioners but I think I do speak on behalf of all the commissioners. I appreciate the work you’ve put into this. From all the angles and certainly you know taking a look at how it would affect your neighbors, your property and then also the needs that you have. The personal needs you have. Noreen Hoft: Thank you Steve. Weick: In order to want to do something like this so I think we all appreciate that. But we also you know have other things to consider as well so just from a question standpoint, you mentioned the tree removal. With your proposed location of the walkway and the screened porch, and we could certainly ask your contractor as well but would you have to remove any trees of significance to do that? Noreen Hoft: They would be maybe an inch and a half in diameter that I could actually take you know a hand saw to myself. Weick: Okay. Noreen Hoft: But the other side, east side has full sized trees. Weick: Okay. And the east side is the alternative C correct and a little bit of B? That’s the east right? Reeder: Yeah, that’s the east. Noreen Hoft: That would be helpful. Thanks very much MacKenzie. Yeah so C is the east side. Weick: C and then B is kind of sticking out there on the east. Chanhassen Planning Commission – October 15, 2019 8 Noreen Hoft: Yes that’s the sore thumb. Weick: Okay. And then you mentioned that you didn’t really have a chance, or you did to look at Option A. Noreen Hoft: Yeah I didn’t know that Option A was being considered. All things considered in terms of my husband’s disability, you know and again Jay can probably speak to this more than I can. We have a rather narrow kitchen door that his wheelchair may not go out as well as it will a sliding glass door. Weick: Okay. Those were kind of some of the things I wanted to clarify but I certainly would open it up, commissioners just jump in and speak up if you have questions. Tietz: No, well done. Noreen Hoft: Thank you. Weick: Mr. Reeder, anything? Reeder: Well you haven’t seen A before? What’s your thought about A? Noreen Hoft: Well that was the one to which I referred that the egress from my kitchen to behind the garage would have just a single narrow door through which a wheelchair would not move. You know so I wouldn’t be able to get a wheelchair out there. I can get a wheelchair out the sliding glass door and also I think Doug since this is the first time I’ve seen it, again it’s more opinion than having to do with code because by code it works right. So in terms of my interest for the aesthetics and you know with going to the option that we proposed you’re kind of in a treehouse. You know you’re up one level. We’ll have a view over the top of the Klaysmat’s house. You know we’ll actually be able to see over their house. Watch the leaves change. It would be a whole different experience behind the garage so aesthetics wise it doesn’t appeal to me at all. Weick: Any follow up on that or? No, okay thank you. Noreen Hoft: You’re welcomed. Thank you for your time and attention. I appreciate it. Weick: Appreciate it. At this time we will open the public hearing portion and invite anyone to come forward who would like to offer an opinion on this item. Just do state your name and address for the record and microphone when you come up. Jay Aos: I’m Jay Aos, owner of AOS Construction. Noreen has proposed hiring to me to do this project for her. So I have a number of thoughts, some of them have developed as we have discussed and things and seen the presentation through the evening. The primary concern I Chanhassen Planning Commission – October 15, 2019 9 would have with the proposed red Alternative C location, the grading on the end of the house there is fairly steep and there’s already a lot of erosion from water coming across the back yard and running right through that area that I’d be concerned about putting footings on that slope and the fact that there is a slope there, earth tends to travel downhill slowly over time and shift and settle and so with those footings I’d be concerned about them moving minutely inches over the years to where the posts would get out of plum and the addition could sag. Plus the concern of the erosion of water around those footings. Up on the back yard where we would like to build the screened porch we have a more level surface and water has been diverted away from that area by landscaping specifically to create a space that would work well for that in the past so. That’s my primary concern about Alternative C. Secondly my concern about Alternative A in blue behind the garage, the design of that space doesn’t allow it to really be usable for a screened porch especially with access for Noreen’s husband to get down there. The reason I say that is the kitchen door comes out at a floor level that is a couple feet off of the ground and the garage soffit across the back there is only about 8 or 9 feet off the ground as it is so we would be trying to build a screened porch with a soffit coming out at about 6 1/2 to 7 feet above the floor of the screen porch in order to keep that floor level so we didn’t have stairs or a ramp to transverse with a wheelchair which ramps are doable but not ideal. So it makes it very hard, especially in light of the fact that that door is narrow there. If they did go out the patio door where the green walkway is they’d have to go quite a ways around an unscreened area through the bugs to get to a screened porch in the back yard behind the garage. So there’s that design consideration. It just makes it very, very hard to have a useable space there that really functions well for them. In fact if it were my home personally I would not want to use that space because it’d be so far to get to it and the wheelchair would present such a difficulty to get there. Those would be my main concerns about those two alternatives. I do believe that the proposed location that we would like to build, which would require the 6 foot variance, is by far the most comfortable, enjoyable scenario. One of the reasons I say that, I know that Noreen’s husband has been a hunter throughout his life and an outdoorsman. Avid outdoorsman. I’m a hunter myself. I love the woods and for, I can only imagine if I were in a stage of Huntington’s Disease like he’s in, he would want as much time outside in his back yard in those trees and woods as he could get because that’s a place that he loves. Off the end of house in the red zone you’d have a lot of view of the yard and the street. Back in the green where we would like to build it you’re very much secluded from that and you’re really in the woods. I think it makes a very ideal spot for him, highly preferable than either other location as well. Any questions for me? Noreen Hoft: Jay could you make a comment that B in the green is a free standing 12 by 12 off the side the house. It’s like, there’s no wall. Jay Aos: I see. Okay. So the free standing idea, that would add a significant cost to the project because we would have to add structural bracing to a free standing structure as well as additional footings and posts. That would make this project quite a bit more expensive for the Hoft’s than what we are proposing to do. Weick: Okay. Any questions? Thank you. Chanhassen Planning Commission – October 15, 2019 10 Jay Aos: Okay. Weick: Appreciate it. Jay Aos: Yep. Weick: Hello and welcome. Brigid Klaysmat: Hello. I’m Brigid Klaysmat at 800 Woodhill Drive. Weick: Welcome. Brigid Klaysmat: So I think that, I mean watching Mike go through this process of this illness and seeing all the things taken away from him I ditto what Jay said that having that screened porch would be very important for him to be outside and having the ease of getting through is super important and I think that it would be a great addition for his life and to make her life better and I think that you guys should give her the variance. Weick: Thank you. Brigid Klaysmat: My occupation is a physical therapist so I have some experience with people with neurological diseases and see how they affect families and mobility and I think like I said it would be a really good addition. Really help them out. Thanks. Weick: Thank you. Shelby Manion: Hi. Weick: Hello and welcome. Shelby Manion: Thank you. My name is Shelby Manion and I live at 825 Lone Eagle and I don’t know how many of you are even aware of the Carver Beach area and stuff and so, and if you are you then you know the history that all of our lots were camp sites so that’s why all of our lots are 20 feet wide by 100 to 125 feet deep. Those are camp sites. So yes we’ve lived there for going on 30 years and the proposed suggestions I personally feel just do not fly. Do not fly at all. Especially the one on the west side because the whole idea is to be, to be able to experience the nature and if you put that on the west side off behind the garage there are no trees there. That is a more open area. That would be completely in the sun. You would see the street. Everything. So right away when I saw that I saw that I went, no way. The other side I could see but there again the point is of the grade. Now Noreen and Mike have put a lot into their yard in the last 2 years but a lot this year to help with the runoff that has, the natural river that ran through there from the day we moved in we would watch the river run down the hill and so to, Chanhassen Planning Commission – October 15, 2019 11 with that and they put in that dry river bed. That would then go into the, all the work that they’ve done to try to preserve the land and the neighbor’s property so they don’t get water in their basements. Behind where they’re proposing to do this work there, it’s wooded and you have all different size trees and everything and we as neighbors take care of those trees. We spent one weekend pruning and taking out dead trees and taking down little trees so that it would give the chance for the other trees to grow. So I feel that we as a community on our two blocks and our back doors take care of each other and my husband and I are saying give them the variance. It’s a go. Thank you. Weick: Thank you. And seeing no one else coming forward I will close the public portion of the hear and now turn to the commissioners for comment, consideration, thoughts, motions. Tietz: Well comments Steve. Weick: Yeah. Tietz: This is truly a unique neighborhood. I don’t think you will ever see one like it again. It dates back to what, 1927 I think and I think it was the Star and Tribune that used to sell, sold those lots to get people out of the city. Reeder: Is that right? Tietz: Yeah. And it, I mean we have a little bit of everything and I think dealing with a little bit of everything we have to be a little bit more lenient because everything is an odd shape and you know we just can’t apply today’s standards very well in an environment such as that. You know the site is, I’ve looked at it. It’s wooded. There’s a lot of privacy there. I really don’t think that this has an encumbrance upon anybody. I think it’s an appropriate addition to their home given what their needs are and I think it looks like that back side would be for the contractor to build onto that, getting roof lines tied in is going to be a lot easier than trying to do it, you know roof lines are always difficult to try to match up and there’s a high wall in that, it appears to be a high wall in that side of the home which would make it not easy but adaptable so those are my comments. Weick: And you know clearly we have agreement amongst neighbors about how this would look. The other thing we have to consider is you know in the future different people move in and behind and just to make sure that we’re considering you know future homeowners. Not in this house but in neighboring houses as well. Not that this is, you know I’m not implying that this is a significant encroachment on the, onto the property but it is a variance and so those are the things we do need to consider as we consider variances. And again just for clarification, if we look at the actual, for you guys I’m on page 2 of 7. We’re just talking about the blue section that juts out. The green part is open as I understand it. So we’re really talking about the blue. The blue that stands out. And I didn’t think about shape but you would know about costs more than I would. I assume that there’s cost ramifications if you change the shape, right? Chanhassen Planning Commission – October 15, 2019 12 Jay Aos: Yep. Undestad: And I think I would agree with Commissioner Tietz on that too that you know we’ve seen a number of variances coming through in the Carver Beach and everything down there is kind of a mix and match so, you know then again I think the neighbors have all communicated well with each other in there, that they’re all kind of in agreement with it and. Weick: Okay. Undestad: And I think the other fact that they’ve done what they could to take care of that water runoff and stuff I don’t think we want to add to that running out the back and down the hill and anything they do back there to get equipment or anything to build that deck out the back is going to turn up that ground and there could be more issues. Weick: Okay. Reeder: I agree. I think because of the way the lot is shaped they have an unusually small back yard to deal with to put a porch which is where you want to put a porch so I think the 6 foot encroachment is not very drastic, especially considering where the houses behind area. I mean this is facing their garages and I think it’s, no matter who lives in any of the houses I don’t think that we’re putting something real close to somebody else and they’ve got to deal with the way the lots are laid out and you know so I’m okay. I think the justification is the shape of the lot that they’re on and where the house is and I’m okay. Tietz: Well should I make a motion? Weick: The floor is your’s. Tietz: Okay. The Chanhassen Board of Appeals and Adjustments approves, oh a double approves here. Approves and approves. We’re approving and approving the 6 foot rear yard setback variance for the construction of a screened porch and walkway subject to the conditions of approval and adopt the attached Findings of Fact and Decision. Weick: We have a valid motion. Do we have a second? Undestad: Second. Weick: We also have a second. I will pause for any comment. Thoughts? Hearing none. Tietz moved, Undestad seconded that the Chanhassen Board of Appeals and Adjustments approves a 6 foot rear setback variance for the construction of a screened porch subject to the following conditions, and adopts the attached Findings of Fact and Decision: Chanhassen Planning Commission – October 15, 2019 13 1. The applicant must apply for and receive a building permit. 2. Provide an updated survey with permit submittals that illustrates all existing utilities on site and is in accordance with City Code of Ordinances Sec. 7-19. 3. A 10 foot wide utility easement shall be recorded in perpetuity with the property for the maintenance and repair of the storm sewer pipe and manhole located on the subject property. This easement shall extend to the southern property line in order to access the storm sewer pipe. All voted in favor and the motion carried unanimously with a vote of 4 to 0. Weick: The variance is approved 4 to 0. Thank you for coming in. Noreen Hoft: Thank you. Weick: And your presentation. APPROVAL OF MINUTES. Commissioner Undestad noted the verbatim and summary Minutes of the Planning Commission meeting dated October 1, 2019 as presented. COMMISSION PRESENTATIONS. None. ADMINISTRATIVE PRESENTATIONS. Aanenson: I have a couple updates if I may. Weick: Yes. Aanenson: So our next meeting we have the extra week so our next meeting would be November 5th but because that’s an election day we will not be meeting so we actually have 4 weeks off. We do have items coming on your next meeting which would be November 19th so at that meeting we’re going to do some code amendments. Walters: Eleven. Aanenson: Eleven code amendments. Those were presented to the City Council last night to get their feedback so there’s some random ones all over and just give you an update of some other stuff that’s going on around town. Weick: Yes. Chanhassen Planning Commission – October 15, 2019 14 Aanenson: The Venue is pretty much almost all leased out. That’s been. Weick: Wow. Aanenson: Yes one of our former planning commissioners moved her mother there and they just love it. She’s real happy to have her mother in town and can walk to everything. Having said that Aldi’s is having their grand opening on Thursday so let you know about that. Riley Crossings, we did take a tour of that with our commission’s tours. They have a temporary CO so they are moving equipment in. Getting some of the training in but they’re hoping here in the next couple weeks to have their permanent CO so they can have residents move in. They’re giving tours also as part of that temporary CO so they’re well on their way to completion. I also want, maybe you’ve seen it but the, the construction of the Tequila Butcher, the parking lot going across the street that you saw the 24 spaces and they’re working on their remodeling so that’s under way. Last night at the City Council they approved a liquor license for Jimmie’s Old Southern BBQ. That’s kind of a takeoff of Famous Dave’s so it’s going in the old Cheers building on West 79th so we’re going to be restauranted up on West 79th so there’s about 6 liquor and seating for about 60 so. Then there’s also a couple other projects under way. If you recall Control Concepts came back with a smaller building and then less grading to get that trail crossing so they’re working on that grading right now but that project is also underway. So I think that’s the main stuff I wanted to talk to you about so we do anticipate for sure the code amendments on the 19th. The only wild card out there is the Perkin’s site. They’re looking at potentially another user there. They may want a drive thru. It’s a PUD that restricts it to 2 drive thru’s so we’re asking them to do a traffic study. One of the users is pretty intensive for traffic so we’ll see kind of so I think they’re just going to try to show what the outside numbers would be and then kind of see what they can get for the users, and I can’t read your writing. Walters: Oh a sign amendment that might be in there as well. Aanenson: Oh yeah, so as part of that they want to do a tall, another tall pylon sign. We do allow pylon signs along Highway 5 so. And then we do anticipate the brewery application coming in December and we thought they might be in in November but it looks like they’ll probably be in December so they’ve been working. We’ve had a couple meetings with them so we’ll see where they’re at so that’s where we are on applications. I don’t know if you have any questions for us of things that are going on around town but. Alright that’s all I had. Thank you. Weick: Thank you Kate. With that I will accept a motion for adjournment. Undestad moved, Reeder seconded to adjourn the meeting. All voted in favor and the motion carried unanimously with a vote of 4 to 0. The Planning Commission meeting was adjourned at 7:55 p.m. Submitted by Kate Aanenson Community Development Director Prepared by Nann Opheim CITY COUNCIL STAFF REPORT Tuesday, November 12, 2019 Subject Resolution 2019XX: Authorize Condemnation Offers for CSAH 101 RightofWay Acquisition Section CONSENT AGENDA Item No: D.3. Prepared By Bruce Loney, Interim Public Works Dir./City Engineer File No: PROPOSED MOTION “The City Council adopts a resolution authorizing condemnation of land for public purposes associated with the CSAH 101 Project Improvements, Pioneer Trail to Flying Cloud Drive.” Approval requires a Simple Majority Vote of members present. BACKGROUND The CSAH 101 improvements will expand and realign CSAH 101 to a fourlane divided urban roadway section between Pioneer Trail and Flying Cloud Drive. The project generally consists of grading, paving, storm sewer, pedestrian bridges, a pedestrian underpass, trails, retaining walls, ponds, street lighting, water main, and sanitary sewer construction. The City is the lead agency for the project, but the improvements are being implemented through a partnership with Carver County and MnDOT. The roadway was a State Trunk Highway, but the jurisdiction was transferred to Carver County on December 31, 2018. The City Council approved a Joint Powers Agreement with Carver County on October 8, 2018 that details the specifics of the relationship between the City and the County. Rightofway appraisals have been completed with offers to all parcels. A reasonable attempt has been made to negotiate a settlement. In order to keep the project on schedule for construction in the spring of 2020, condemnation proceedings need to commence. City Council has approved plans for the CSAH 101 project from Pioneer Trail to CSAH 61 on October 14, 2019. DISCUSSION The attached resolution and map show and describe all the parcels that have not yet been settled. The resolution was drafted by Bob Lindall of Kennedy & Graven, Inc. with assistance from Sonya Henning of Henning Professional Services and mapping prepared by KimleyHorn, Inc. RECOMMENDATION Staff recommends adoption of the attached resolution. CITY COUNCIL STAFF REPORTTuesday, November 12, 2019SubjectResolution 2019XX: Authorize Condemnation Offers for CSAH 101 RightofWay AcquisitionSectionCONSENT AGENDA Item No: D.3.Prepared By Bruce Loney, Interim Public WorksDir./City Engineer File No: PROPOSED MOTION“The City Council adopts a resolution authorizing condemnation of land for public purposes associated with theCSAH 101 Project Improvements, Pioneer Trail to Flying Cloud Drive.”Approval requires a Simple Majority Vote of members present.BACKGROUNDThe CSAH 101 improvements will expand and realign CSAH 101 to a fourlane divided urban roadway sectionbetween Pioneer Trail and Flying Cloud Drive. The project generally consists of grading, paving, storm sewer,pedestrian bridges, a pedestrian underpass, trails, retaining walls, ponds, street lighting, water main, and sanitary sewerconstruction.The City is the lead agency for the project, but the improvements are being implemented through a partnership withCarver County and MnDOT. The roadway was a State Trunk Highway, but the jurisdiction was transferred to CarverCounty on December 31, 2018. The City Council approved a Joint Powers Agreement with Carver County onOctober 8, 2018 that details the specifics of the relationship between the City and the County.Rightofway appraisals have been completed with offers to all parcels. A reasonable attempt has been made tonegotiate a settlement. In order to keep the project on schedule for construction in the spring of 2020, condemnationproceedings need to commence.City Council has approved plans for the CSAH 101 project from Pioneer Trail to CSAH 61 on October 14, 2019.DISCUSSIONThe attached resolution and map show and describe all the parcels that have not yet been settled. The resolution wasdrafted by Bob Lindall of Kennedy & Graven, Inc. with assistance from Sonya Henning of Henning ProfessionalServices and mapping prepared by KimleyHorn, Inc.RECOMMENDATION Staff recommends adoption of the attached resolution. ATTACHMENTS: Resolution Eminent Domain Map 1 615886v6CH135-61 CITY COUNCIL OF THE CITY OF CHANHASSEN, MINNESOTA Date: November 12, 2019 Resolution No: _________________ Motion by Council Member: Seconded by Council Member: _________________ Resolution Authorizing Eminent Domain Proceeding to Acquire Real Property Interests Needed for Reconstruction of CSAH 101 - Pioneer Trail to CSAH 61 WHEREAS, the City Council of the City of Chanhassen is the official governing body of the City of Chanhassen (“City”); and WHEREAS, in cooperation with the County of Carver and the State of Minnesota, the City proposes to construct highway and related improvements for the safety of the traveling public in the City of Chanhassen as part of the reconstruction and expansion of County State Aid Highway (CSAH) 101 from Pioneer Trail to County State Aid Highway (CSAH) 61 (“Project”); and WHEREAS, the City, acting by and through its City Council, is authorized by law, and pursuant to Minnesota Statutes, § 465.01; §117.012; and § 117.042, to acquire land and other real property interests in the City of Chanhassen which the City needs for a public use or public purpose; and WHEREAS, to complete the Project, the City must acquire the real property interests described in Exhibit A, attached hereto, from the Owners identified in Exhibit A, attached hereto; and WHEREAS, based upon the appraisal reports of damages obtained by the City from an independent licensed real estate appraiser, and in accordance with authorization of the City Council, the Public Works Director or agents under his supervision have made offers of compensation to owners of affected properties. Despite good faith efforts, negotiations with the Owners for the direct purchase of the proposed acquisitions of the real property interests which the City needs for the Project have been unsuccessful; and WHEREAS, the City Council finds that it is reasonably necessary, proper, and convenient, in furtherance of the Project, and in the interest of the public health, convenience, and general welfare of the citizens of the City, that the City acquire title to and possession of the real property interests described in Exhibit A, including Parcel 13, in its entirety, through use of the power of eminent domain; and WHEREAS, the City has the right pursuant to Minnesota Statutes, § 117.042 to acquire title to and possession of said real property interests prior to the filing of an award by court appointed commissioners; and WHEREAS, the City Council finds that the funding and construction schedule for the Project make it necessary for the City to acquire title to and possession of the real property interests described in Exhibit A prior 2 615886v6CH135-61 to the filing of the final report of the condemnation commissioners to be appointed by the district court. NOW, THEREFORE, BE IT RESOLVED, that City’s acquisition of the real property interests described in Exhibit A from the Owners identified in Exhibit A, and the construction of highway and related improvements for the reconstruction of CSAH 101 from Pioneer Trail to CSAH 61 as part of the Project, constitute a valid public use or public purpose; and BE IT FURTHER RESOLVED, that it is the considered judgment of the City Council that the City should acquire the real property interests described in Exhibit A, from the Owners identified in Exhibit A, for the stated public purposes, and that the City should acquire said real property interests, if necessary, through the exercise of the power of eminent domain; and BE IT FURTHER RESOLVED, that attorneys from Kennedy & Graven, Chartered, the legal counsel retained by the City for this purpose, hereby are authorized to take all steps necessary to acquire the real property interests described in Exhibit A from the Owners identified in Exhibit A, including the filing of the Petition necessary to initiate an action in eminent domain in District Court, and prosecuting such action and all related matters needed to bring the action to a successful conclusion, or until the action is abandoned, dismissed, or terminated by the City or District Court. YES ABSENT NO _________________________ _________________________ _________________________ _________________________ _________________________ _________________________ _________________________ _________________________ _________________________ _________________________ _________________________ _________________________ _________________________ _________________________ _________________________ STATE OF MINNESOTA COUNTY OF CARVER I, Todd Gerhardt, duly appointed and qualified City Manager of the City of Chanhassen, Carver County, State of Minnesota, do hereby certify that I have compared the foregoing copy of this resolution with the original minutes of the proceedings of the City Council, City of Chanhassen, Carver County, Minnesota, at its session held on November 12, 2019, now on file in the Administration office, and have found the same to be a true and correct copy thereof. Dated this November 12, 2019 Todd Gerhardt City Manager of the City of Chanhassen A-1 615886v6CH135-61 EXHIBIT A CSAH 101 Reconstruction – Pioneer Trail to CSAH 61 Parcels 1 and 24 Property Tax Identification No. 25.601-0020 25.601-0010 25.601-0030 Property Address: 10500 and 10520 Great Plains Boulevard, Chaska, Minnesota 55318 Property: Abstract Legal Description of Subject Property: Lots 1 and 2, Block 1 and Outlot A, PAWS CLAWS AND HOOVES ADDITION, Carver County, Minnesota. Legal Description of Portion of Subject Property to Be Acquired in Fee: Parcels 1A, 1B, 1C, 1D and Parcel 24, all as shown on CARVER COUNTY RIGHT OF WAY PLAT No. 29, on file and of record in the office of the County Recorder, Carver County, Minnesota, containing a total of 201,466 square feet, more or less. Description of Portion of Subject Property to Be Encumbered Herein by Temporary Easement for Construction Purposes: Temporary Easement Parcels 1C and 1D, forming and being a part of Parcel 1, as shown on CARVER COUNTY RIGHT OF WAY PLAT No. 29, on file and of record in the office of the County Recorder, Carver County, Minnesota, containing a total of 88,649 square feet, more or less. Term of Temporary Easement: The temporary easement tract will expire on December 31, 2021. Respondents Interests PCH Development, LLC, a Minnesota limited liability company Fee Owner U.S. Small Business Administration Mortgagee Paws, Claws & Hooves Pet Boarding, LLC, a Minnesota limited liability company Tenant City of Chanhassen Special Assessments, if any All other parties unknown, together with unknown successors, assigns, heirs, devisees and spouses, if any Any right, title or interest within the acquired portion of the Subject Property A-2 615886v6CH135-61 Parcel 10 Property Tax Identification No. 25.849-0020 Property Address: Unassigned, Chaska, MN 55318 Property: Abstract Legal Description of Subject Property: Outlot A, TEICH ESTATES, except that part thereof embraced within the plat of City of Chanhassen Official Map No. 1, Carver County, Minnesota. Legal Description of Portion of Subject Property to Be Acquired in Fee: Parcels 10A and 10B, all as shown on CARVER COUNTY RIGHT OF WAY PLAT No. 29, on file and of record in the office of the County Recorder, Carver County, Minnesota, containing a total of 57,653 square feet, more or less. Legal Description of Portion of Subject Property to Be Encumbered Herein by Permanent Easement for Roadway Purposes: A 40.00 foot wide Permanent Roadway Easement Parcel forming and being a part of Parcel 10, as shown on CARVER COUNTY RIGHT OF WAY PLAT No. 29, on file and of record in the office of the County Recorder, Carver County, Minnesota, containing a total of 30,742 square feet, more or less. Legal Description of Portion of Subject Property to Be Encumbered Herein by Permanent Easement for Drainage and Utility Purposes: A 10.00 foot wide Permanent Drainage and Utility Easement Parcel forming and being a part of Parcel 10, as shown on CARVER COUNTY RIGHT OF WAY PLAT No. 29, on file and of record in the office of the County Recorder, Carver County, Minnesota, containing a total of 7,579 square feet, more or less. Description of Portion of Subject Property to Be Encumbered Herein by Temporary Easement for Construction Purposes: Various Temporary Easement Parcels forming and being a part of Parcel 10, as shown on CARVER COUNTY RIGHT OF WAY PLAT No. 29, on file and of record in the office of the County Recorder, Carver County, Minnesota, containing a total of 52,734 square feet, more or less. Term of Temporary Easement: The temporary easement tract will expire on December 31, 2021. Respondents Interests Helen C. Link Fee Owner (Surviving Joint Tenant) Helen C. Link, Trustee, and successor Trustee, of the Helen C. Link Revocable Trust under agreement dated August 16, 1991, as amended and restated Fee Owner City of Chanhassen Special Assessments, if any All other parties unknown, together with unknown successors, assigns, heirs, devisees and spouses, if any Any right, title or interest within the acquired portion of the Subject Property A-3 615886v6CH135-61 Parcel 11 Property Tax Identification No. 25.120-0090 25.120-0100 Property Address: Unassigned Property: Abstract Legal Description of Subject Property: Lots 8 and 9, Block 2, BLUFF CREEK HIGHLANDS, except that part thereof embraced within the plat of City of Chanhassen Official Map No. 1, Carver County, Minnesota. Legal Description of Portion of Subject Property to Be Acquired in Fee: Parcels 11A, 11B and 11C, all as shown on CARVER COUNTY RIGHT OF WAY PLAT No. 29, on file and of record in the office of the County Recorder, Carver County, Minnesota, containing a total of 31,365 square feet, more or less. Description of Portion of Subject Property to Be Encumbered Herein by Temporary Easement for Construction Purposes: Various Temporary Easement Parcels forming and being a part of Parcel 11, as shown on CARVER COUNTY RIGHT OF WAY PLAT No. 29, on file and of record in the office of the County Recorder, Carver County, Minnesota, containing a total of 5,807 square feet, more or less. Term of Temporary Easement: The temporary easement tract will expire on December 31, 2021. Respondents Interests Harry E. Niemela and Judy M. Niemela, as Trustees of The Trust Agreement of Harry and Judy Niemela Fee Owner City of Chanhassen Special Assessments, if any All other parties unknown, together with unknown successors, assigns, heirs, devisees and spouses, if any Any right, title or interest within the acquired portion of the Subject Property A-4 615886v6CH135-61 Parcel 13 Property Tax Identification No. 25.306-0010 Property Address: 670 Creekwood Drive, Chaska, Minnesota Property: Abstract Legal Description of Subject Property: Lot 1, Block 1, HALLA MARYANNE ADDITION, except that part thereof embraced within the plat of City of Chanhassen Official Plat No. 1, Carver County, Minnesota. Legal Description of Portion of Subject Property to Be Acquired in Fee: Lot 1, Block 1, HALLA MARYANNE ADDITION, except that part thereof embraced within the plat of City of Chanhassen Official Plat No. 1, Carver County, Minnesota. Respondents Interests Maryanne Marie Halama, aka Maryanne M. Halama, fka Maryanne M. White Fee Owner (Married to Gary Edward Halama) Gary Edward Halama Inchoate (Married to Maryanne Marie Halama, aka Maryanne M. Halama, fka Maryanne M. White) Mark D. Halla Beneficiary under Transfer on Death Deed Donald E. Halla Mortgagee City of Chanhassen Special Assessments, if any All other parties unknown, together with unknown successors, assigns, heirs, devisees and spouses, if any Any right, title or interest within the acquired portion of the Subject Property A-5 615886v6CH135-61 Parcel 14 Property Tax Identification No. 25.306-0020 Property Address: 720 Creekwood Drive, Chaska, MN 55318 Property: Abstract Legal Description of Subject Property: Outlot A, HALLA MARYANNE ADDITION, except that part thereof embraced within the plat of City of Chanhassen Official Map No. 1, Carver County, Minnesota. Legal Description of Portion of Subject Property to Be Acquired in Fee: Parcel 14, as shown on CARVER COUNTY RIGHT OF WAY PLAT No. 29, on file and of record in the office of the County Recorder, Carver County, Minnesota, containing a total of 50,987 square feet, more or less. Description of Portion of Subject Property to Be Encumbered Herein by Temporary Easement for Construction Purposes: A Temporary Easement Parcel forming and being a part of Parcel 14, as shown on CARVER COUNTY RIGHT OF WAY PLAT No. 29, on file and of record in the office of the County Recorder, Carver County, Minnesota, containing a total of 7,615 square feet, more or less. Term of Temporary Easement: The temporary easement tract will expire on December 31, 2021. Respondents Interests Halla Family Limited Partnership, a Minnesota limited partnership Fee Owner/Lessor Donald E. Halla Original Tenant T-Mobile USA Tower LLC, a Delaware limited liability company Lessor/Tenant T-Mobile Central, LLC, a Delaware limited liability company Original Tenant CCTMO LLC, a Delaware limited liability company Tenant/Attorney-in-Fact for T-Mobile USA Tower LLC City of Chanhassen Special Assessments, if any All other parties unknown, together with unknown successors, assigns, heirs, devisees and spouses, if any Any right, title or interest within the acquired portion of the Subject Property A-6 615886v6CH135-61 Parcel 15 Property Tax Identification No. 25.305-0100 Property Address: 10000 Great Plains Boulevard, Chaska, MN 55318 Property: Abstract Legal Description of Subject Property: Lot 10, Block 1, HALLA GREAT PLAINS ADDITION, except that part thereof embraced within the plat of City of Chanhassen Official Map No. 1, Carver County, Minnesota. Legal Description of Portion of Subject Property to Be Acquired in Fee: Parcel 15 as shown on CARVER COUNTY RIGHT OF WAY PLAT No. 29, on file and of record in the office of the County Recorder, Carver County, Minnesota, containing a total of 3,830 square feet, more or less. Description of Portion of Subject Property to Be Encumbered Herein by Temporary Easement for Construction Purposes: A Temporary Easement Parcel forming and being a part of Parcel 15, as shown on CARVER COUNTY RIGHT OF WAY PLAT No. 29, on file and of record in the office of the County Recorder, Carver County, Minnesota, containing a total of 4,698 square feet, more or less. Term of Temporary Easement: The temporary easement tract will expire on December 31, 2021. Respondents Interests Mark Donald Halla and Kay Marie Halla Fee Owners (Husband and Wife as Joint Tenants) Donald E. Halla _____________________________________ Christopher Hagen ______________________________________ Spouse of Christopher Hagen Possible holder of an interest _____ Contract for Deed Vendee Possible holder of an interest AgStar Financial Services, FLCA Mortgagee AgStar Financial Services, PCA Mortgagee T-Mobile USA Tower LLC, a Delaware limited liability company Lessor T-Mobile Central, LLC, a Delaware limited liability company Original Tenant CCTMO LLC, a Delaware limited liability company Tenant/Attorney-in-Fact for T-Mobile USA Tower LLC City of Chanhassen Special Assessments, if any All other parties unknown, together with unknown successors, assigns, heirs, devisees and spouses, if any Any right, title or interest within the acquired portion of the Subject Property A-7 615886v6CH135-61 Parcels 16A & 16B Property Tax Identification No. 25.025-2800 Property Address: 10001 Great Plains Boulevard, Chaska, MN 55318 Property: Abstract Legal Description of Subject Property: That part of the Southwest Quarter of Section 25, Township 116 North, Range 23 West, described as: Commencing at a point on the North line of said Southwest 1/4 distant 1279.23 feet East of the Northwest corner of said Southwest 1/4, said point being on the center line of State Highway #101; thence South 3 degrees 25 minutes West 198.77 feet; thence Southwesterly 401.01 feet along a tangential curve to the left, having a radius of 546.83 feet; thence South 45 degrees 26 minutes West 826.78 feet; thence South 23 degrees 51 minutes East 158.43 feet; thence South 89 degrees 08 minutes East 189.2 feet to the point of beginning of the land to be described; thence South 89 degrees 08 minutes East 444.45 feet; thence South 34 degrees 42 minutes 50 seconds West 685.20 feet to the center line of State Highway No.101; thence North 16 degrees 21 minutes West 26.66 feet; thence Northwesterly 129.68 feet along a tangential curve to the left, having a radius of 468.92 feet; thence North 0 degrees 52 minutes East 426.59 feet to the actual point of beginning. EXCEPT: That part of the West Half of the Southwest Quarter of Section 25, Township 116 North, Range 23 West, shown as Parcel 3 on Minnesota Department of Transportation Right of Way Plat Numbered 10-45 as the same is on file and of record in the office of the County Recorder in and for Carver County, Minnesota. Legal Description of Portion of Subject Property to Be Acquired in Fee: Parcel 16 as shown on CARVER COUNTY RIGHT OF WAY PLAT No. 29, on file and of record in the office of the County Recorder, Carver County, Minnesota, containing a total of 4,055 square feet, more or less. Legal Description of Portion of Subject Property to Be Encumbered Herein by Permanent Easement for Drainage and Utility Purposes: A Permanent Drainage and Utility Easement Parcel forming and being a part of Parcel 16, as shown on CARVER COUNTY RIGHT OF WAY PLAT No. 29, on file and of record in the office of the County Recorder, Carver County, Minnesota, containing a total of 15,255 square feet, more or less. Description of Portion of Subject Property to Be Encumbered Herein by Temporary Easement for Construction Purposes: Various Temporary Easement Parcels forming and being a part of Parcel 16, as shown on CARVER COUNTY RIGHT OF WAY PLAT No. 29, on file and of record in the office of the County Recorder, Carver County, Minnesota, containing a total of 12,707 square feet, more or less. Term of Temporary Easement: The temporary easement tract will expire on December 31, 2021. Respondents Interests Thomas J. Gertz Fee Owner (Surviving Joint Tenant) Mortgage Electronic Registration Systems, Inc., a Delaware corporation, as nominee for American Mortgage Corporation, a Minnesota corporation Mortgagee A-8 615886v6CH135-61 U.S. Bank National Association, fka U.S. Bank National Association, ND Mortgagee City of Chanhassen Special Assessments, if any All other parties unknown, together with unknown successors, assigns, heirs, devisees and spouses, if any Any right, title or interest within the acquired portion of the Subject Property A-9 615886v6CH135-61 Parcel 17 Property Tax Identification No. 25.025-2600 Property Address: 10001 Great Plains Boulevard, Chaska, MN 55318 Property: Abstract Legal Description of Subject Property: That part of the Southwest Quarter of Section 25, Township 116 North, Range 23 West, Carver County, Minnesota, described as: Commencing at a point in the North line of said Southwest 1/4 distant 1279.23 feet East of the Northwest corner of said Southwest 1/4, said point being on the center line of State Highway #101; thence South 3 degrees 25 minutes West 198.77 feet; thence Southwesterly 401.01 feet along a tangential curve to the left, having a radius of 546.83 feet; thence South 45 degrees 26 minutes West 826.78 feet to the actual point of beginning of the land to be described; thence South 23 degrees 51 minutes East 158.43 feet; thence South 89 degrees 08 minutes East 633.65 feet; thence South 34 degrees 42 minutes 50 seconds West 685.20 feet to the center line of State Highway #101; thence North 16 degrees 21 minutes West 26.66 feet; thence Northwesterly 355.88 feet along a tangential curve to the left, having a radius of 468.92 feet; thence North 59 degrees 50 minutes West 96.50 feet; thence Northwesterly 385.82 feet along a tangential curve to the right having a radius of 210 feet; thence North 45 degrees 26 minutes East, 55.68 feet to the actual point of beginning. EXCEPTING THEREFROM: That part of the Southwest Quarter of Section 25, Township 116 North, Range 23 West, described as: Commencing at a point on the North line of said Southwest 1/4 distant 1279.23 feet East of the Northwest corner of said Southwest 1/4, said point being on the center line of State Highway #101; thence South 3 degrees 25 minutes West 198.77 feet; thence Southwesterly 401.01 feet along a tangential curve to the left, having a radius of 546.83 feet; thence South 45 degrees 26 minutes West 826.78 feet; thence South 23 degrees 51 minutes East 158.43 feet; thence South 89 degrees 08 minutes East 189.2 feet to the point of beginning of the land to be described; thence South 89 degrees 08 minutes East 444.45 feet; thence South 34 degrees 42 minutes 50 seconds West 685.20 feet to the center line of State Highway #101; thence North 16 degrees 21 minutes West 26.66 feet; thence Northwesterly 129.68 feet along a tangential curve to the left, having a radius of 468.92 feet; thence North 0 degrees 52 minutes East 426.59 feet to the actual point of beginning. ALSO EXCEPT: That part of the West Half of the Southwest Quarter of Section 25, Township 116 North, Range 23 West, shown as Parcel 3 on Minnesota Department of Transportation Right of Way Plat Numbered 10-45 as the same is on file and of record in the office of the County Recorder in and for Carver County, Minnesota. Legal Description of Portion of Subject Property to Be Acquired in Fee: Parcels 17A, 17B, 17C and 17D, all as shown on CARVER COUNTY RIGHT OF WAY PLAT No. 29, on file and of record in the office of the County Recorder, Carver County, Minnesota, containing a total of 75,386 square feet, more or less. Description of Portion of Subject Property to Be Encumbered Herein by Temporary Easement for Construction Purposes: A Temporary Easement Parcel forming and being a part of Parcel 17, as shown on CARVER COUNTY RIGHT OF WAY PLAT No. 29, on file and of record in the office of the County Recorder, Carver County, Minnesota, containing a total of 5,632 square feet, more or less. Term of Temporary Easement: A-10 615886v6CH135-61 The temporary easement tract will expire on December 31, 2021. Respondents Interests Thomas J. Gertz Fee Owner (Surviving Joint Tenant) Mortgage Electronic Registration Systems, Inc., a Delaware corporation, as nominee for American Mortgage Corporation, a Minnesota corporation Mortgagee U.S. Bank National Association, fka U.S. Bank National Association, ND Mortgagee City of Chanhassen Special Assessments, if any All other parties unknown, together with unknown successors, assigns, heirs, devisees and spouses, if any Any right, title or interest within the acquired portion of the Subject Property A-11 615886v6CH135-61 Parcel 18 Property Tax Identification No. 25.305-0190 Property Address: 495 Pioneer Trail, Chaska, MN 55318 Property: Abstract Legal Description of Subject Property: All that part of the Southwest Quarter (SW 1/4) of Section 25, Township 116, Range 23, formerly known as Halla Great Plains Addition; vacated Lots 1 through 9, Block 2; vacated Lots 1 through 2, Block 3; vacated Lots 1 through 2, Block 4; vacated Lots 1 through 3, Block 5; vacated Lot 1, Block 6 and vacated Outlot A, all in the recorded plat of Halla Great Plains Addition, except that part thereof embraced within the plat of City of Chanhassen Official Map No. 1, Carver County, Minnesota. Legal Description of Portion of Subject Property to Be Acquired in Fee: Parcels 18A, 18B, 18C, 18D and 18E, all as shown on CARVER COUNTY RIGHT OF WAY PLAT No. 29, on file and of record in the office of the County Recorder, Carver County, Minnesota, containing a total of 96,953 square feet, more or less. Legal Description of Portion of Subject Property to Be Encumbered Herein by Permanent Easement for Drainage and Utility Purposes: A Permanent Drainage and Utility Easement Parcel forming and being a part of Parcel 18, as shown on CARVER COUNTY RIGHT OF WAY PLAT No. 29, on file and of record in the office of the County Recorder, Carver County, Minnesota, containing a total of 900 square feet, more or less. Description of Portion of Subject Property to Be Encumbered Herein by Temporary Easement for Construction Purposes: Various Temporary Easement Parcels forming and being a part of Parcel 18, as shown on CARVER COUNTY RIGHT OF WAY PLAT No. 29, on file and of record in the office of the County Recorder, Carver County, Minnesota, containing a total of 10,434 square feet, more or less. Term of Temporary Easement: The temporary easement tract will expire on December 31, 2021. Respondents Interests Halla Family Limited Partnership, a limited partnership under the laws of Minnesota Fee Owner Bremer Bank, National Association, fka First State Bank of Eden Prairie Mortgagee Donald E. Halla Landlord T-Mobile Central LLC, a Delaware limited liability company Tenant T-Mobile USA Tower LLC, a Delaware limited liability company Landlord CCTMO LLC, a Delaware limited liability company Tenant/Attorney-in-Fact for T-Mobile USA Tower LLC City of Chanhassen Special Assessments A-12 615886v6CH135-61 All other parties unknown, together with unknown successors, assigns, heirs, devisees and spouses, if any Any right, title or interest within the acquired portion of the Subject Property A-13 615886v6CH135-61 Parcel 19 Property Tax Identification No. 25.305-0010 Property Address: 9885 Raspberry Hill, Chaska, MN 55318 Property: Abstract Legal Description of Subject Property: Lot 1, Block 1, HALLA GREAT PLAINS ADDITION, Carver County, Minnesota. Legal Description of Portion of Subject Property to Be Acquired in Fee: Parcel 19 as shown on CARVER COUNTY RIGHT OF WAY PLAT No. 29, on file and of record in the office of the County Recorder, Carver County, Minnesota, containing a total of 4,220 square feet, more or less. Respondents Interests Nancy J. Rossberg, Trustee, or her successors, of the Nancy J. Rossberg Revocable Trust dated October 15, 1998 Fee Owner City of Chanhassen Special Assessments, if any All other parties unknown, together with unknown successors, assigns, heirs, devisees and spouses, if any Any right, title or interest within the acquired portion of the Subject Property A-14 615886v6CH135-61 Parcel 20A & 20B Property Tax Identification No. 25.305-0020 Property Address: 9865 Raspberry Hill, Chaska, MN 55318 Property: Abstract Legal Description of Subject Property: Lot 2, Block 1, HALLA GREAT PLAINS ADDITION, except that part thereof which is contained within Parcel 24, Minnesota Department of Transportation Right of Way Plat No. 10-22, Carver County, Minnesota. Legal Description of Portion of Subject Property to Be Acquired in Fee: Parcel 20 as shown on CARVER COUNTY RIGHT OF WAY PLAT No. 29, on file and of record in the office of the County Recorder, Carver County, Minnesota, containing a total of 7,849 square feet, more or less. Description of Portion of Subject Property to Be Encumbered Herein by Temporary Easement for Construction Purposes: A Temporary Easement Parcel forming and being a part of Parcel 20, as shown on CARVER COUNTY RIGHT OF WAY PLAT No. 29, on file and of record in the office of the County Recorder, Carver County, Minnesota, containing a total of 3,476 square feet, more or less. Term of Temporary Easement: The temporary easement tract will expire on December 31, 2021. Respondents Interests Halla Family Limited Partnership, a Minnesota limited partnership Fee Owner Donald E. Halla Original Lessor T-Mobile USA Tower LLC, a Delaware limited liability company Lessor T-Mobile Central, LLC Original Tenant CCTMO LLC, a Delaware limited liability company Tenant/Attorney-in-Fact for T-Mobile USA Tower LLC City of Chanhassen Special Assessments, if any All other parties unknown, together with unknown successors, assigns, heirs, devisees and spouses, if any Any right, title or interest within the acquired portion of the Subject Property A-15 615886v6CH135-61 Parcel 28 Property Tax Identification No. 25.120-0060 Property Address: 10271 Great Plains Boulevard, Chaska, MN 55318 Property: Abstract Legal Description of Subject Property: Lot 5, Block 2, BLUFF CREEK HIGHLANDS, Carver County, Minnesota. Legal Description of Portion of Subject Property to Be Encumbered Herein by Permanent Easement for Retaining Wall Purposes: Parcel 28 as shown on CARVER COUNTY RIGHT OF WAY PLAT No. 29, on file and of record in the office of the County Recorder, Carver County, Minnesota, containing a total of 144 square feet, more or less. Description of Portion of Subject Property to Be Encumbered Herein by Temporary Easement for Construction Purposes: A Temporary Easement Parcel forming and being a part of Parcel 28, as shown on CARVER COUNTY RIGHT OF WAY PLAT No. 29, on file and of record in the office of the County Recorder, Carver County, Minnesota, containing a total of 13,282 square feet, more or less. Term of Temporary Easement: The temporary easement tract will expire on December 31, 2021. Respondents Interests Richard T. Halver and Patricia J. Halver Fee Owners (Husband and Wife, as Joint Tenants) Matthew R. Halver Beneficiary under Transfer on Death Deed (Tenant in Common) Thomas R. Halver Beneficiary under Transfer on Death Deed (Tenant in Common) City of Chanhassen Special Assessments, if any All other parties unknown, together with unknown successors, assigns, heirs, devisees and spouses, if any Any right, title or interest within the acquired portion of the Subject Property A-16 615886v6CH135-61 Parcel 29 Property Tax Identification No. 25.120-0080 Property Address: 10251 Great Plains Boulevard, Chaska, MN 55318 Property: Abstract Legal Description of Subject Property: Lot 7, Block 2, BLUFF CREEK HIGHLANDS, Carver County, Minnesota. Description of Portion of Subject Property to Be Encumbered Herein by Temporary Easement for Construction Purposes: Parcel 29 as shown on CARVER COUNTY RIGHT OF WAY PLAT No. 29, on file and of record in the office of the County Recorder, Carver County, Minnesota, containing a total of 12,016 square feet, more or less. Term of Temporary Easement: The temporary easement tract will expire on December 31, 2021. Respondents Interests Renee L. Strickland Fee Owner Wings Financial Credit Union, a Minnesota credit union Mortgagee City of Chanhassen Special Assessments, if any All other parties unknown, together with unknown successors, assigns, heirs, devisees and spouses, if any Any right, title or interest within the acquired portion of the Subject Property CITY COUNCIL STAFF REPORT Tuesday, November 12, 2019 Subject Resolution 2019XX: Approve Transfer of Remaining 2018 General Fund Surplus Section CONSENT AGENDA Item No: D.4. Prepared By Greg Sticha, Finance Director File No: PROPOSED MOTION "The City Council Adopts a Resolution transferring the remaining 2018 General Fund Surplus to the Park Equipment Replacement Fund." Approval requires a Simple Majority Vote of members present. BACKGROUND Staff is including and recommending transfer of the remaining $350,000 remaining 2018 General Fund surplus: 1. The 2018 audit is complete and the city's General Fund had a surplus of $846,459. During 2018, a parks master plan study was completed and part of the study indicated the need to create an annual park replacement program to replace various playgrounds and other amenities in our parks. Staff had discussions with the City Council and presented a schedule that would replace $250,000/year. As a part of last year's General Fund surplus, the City Council transferred roughly $400,000 into this new fund. The transfer of an additional $350,000 will give the fund three years worth of replacement equipment expenses (through 2021), at which point in time a permanent revenue stream would need to be found to continue purchasing $250,000 in park replacement equipment. ATTACHMENTS: Resolution 1 CITY OF CHANHASSEN CARVER AND HENNEPIN COUNTIES, MINNESOTA DATE: November 12, 2019 RESOLUTION NO: 2019- XX MOTION BY: SECONDED BY: RESOLUTION AUTHORIZING 2019 FUND TRANSFER FROM 2018 GENERAL FUND SURPLUS WHEREAS, the city’s auditors have completed the 2018 Financial Audit. Staff has identified the General Fund Surplus as of December 31, 2018 to be $846,459 and recommends the transfer of the remaining $350,000 of General Fund Surplus to the Park Equipment Replacement Fund . NOW, THEREFORE, BE IT RESOLVED by the City Council of Chanhassen, Minnesota, as follows: 1. Authorization: The City Council hereby authorizes the Finance Director to transfer the following amounts as shown: From Fund To Fund Amount 101 General Fund 401 $350,000.00 Passed and adopted by the Chanhassen City Council this 12th day of November, 2019. ATTEST: Todd Gerhardt, City Manager Elise Ryan, Mayor YES NO ABSENT CITY COUNCIL STAFF REPORT Tuesday, November 12, 2019 Subject Resolution 2019XX: Approval of Plans & Specifications and Authorize Advertisement for Bids for the Powers Boulevard/Lake Lucy Road Pedestrian Project; Approve Amendment to Consulting Engineering Contract Section CONSENT AGENDA Item No: D.5. Prepared By Bruce Loney, Interim Public Works Dir./City Engineer File No: PW031A PROPOSED MOTION “The City Council adopts a resolution approving plans and specifications and authorizing advertisement of bids for the Powers Boulevard/Lake Lucy Road Pedestrian Improvements;" And, "The City Council approves an amendment to the consulting engineering contract for design and construction services with Bolton & Menk, Inc. in the amount of $5,500.00." Approval requires a Simple Majority Vote of members present. BACKGROUND On March 26, 2018, the City Council entered into a Joint Powers Agreement (JPA) with Carver County to study pedestrian crossings on Powers Boulevard. Specifically, two crossings were identified for the study. The crossings are at Lake Lucy Road and Park Road. These locations had been identified by the city and county as areas of potential safety concern. In addition, residents and local businesses had expressed concern about these crossings as well. The study gathered existing traffic data, crash information and pedestrian movements at each crossing. Based on that data, proposed improvements were developed for both crossings. Some of the improvements for the Park Road crossing were implemented last year. This included the addition of advanced warning signs and enhancements to the pedestrian activated crossing. No improvements have been completed yet for the Lake Lucy Road pedestrian crossing. The county had previously taken the lead on completing the study for this crossing. However, the county has stated that they do not have the staff availability to take the lead on completing the final construction documents and constructing the actual improvements. The city will therefore be taking the lead on moving forward with the Lake Lucy Road improvement. The total estimated cost for the project is $699,792.25 per the JPA with Carver County, the cost will be essentially split 50/50 between the county and the city with adjustments for utility work to the city. Estimated cost for the project CITY COUNCIL STAFF REPORTTuesday, November 12, 2019SubjectResolution 2019XX: Approval of Plans & Specifications and Authorize Advertisement for Bidsfor the Powers Boulevard/Lake Lucy Road Pedestrian Project; Approve Amendment toConsulting Engineering ContractSectionCONSENT AGENDA Item No: D.5.Prepared By Bruce Loney, Interim Public WorksDir./City Engineer File No: PW031APROPOSED MOTION“The City Council adopts a resolution approving plans and specifications and authorizing advertisement of bids forthe Powers Boulevard/Lake Lucy Road Pedestrian Improvements;"And,"The City Council approves an amendment to the consulting engineering contract for design and constructionservices with Bolton & Menk, Inc. in the amount of $5,500.00."Approval requires a Simple Majority Vote of members present.BACKGROUNDOn March 26, 2018, the City Council entered into a Joint Powers Agreement (JPA) with Carver County to studypedestrian crossings on Powers Boulevard. Specifically, two crossings were identified for the study. The crossingsare at Lake Lucy Road and Park Road. These locations had been identified by the city and county as areas ofpotential safety concern. In addition, residents and local businesses had expressed concern about these crossings aswell.The study gathered existing traffic data, crash information and pedestrian movements at each crossing. Based on thatdata, proposed improvements were developed for both crossings. Some of the improvements for the Park Roadcrossing were implemented last year. This included the addition of advanced warning signs and enhancements to thepedestrian activated crossing. No improvements have been completed yet for the Lake Lucy Road pedestrian crossing. The county had previouslytaken the lead on completing the study for this crossing. However, the county has stated that they do not have the staffavailability to take the lead on completing the final construction documents and constructing the actual improvements. The city will therefore be taking the lead on moving forward with the Lake Lucy Road improvement. The total estimated cost for the project is $699,792.25 per the JPA with Carver County, the cost will be essentially split 50/50 between the county and the city with adjustments for utility work to the city. Estimated cost for the project for Chanhassen is $351,965.16. The City's capital improvement plan included funding in 2019 for these improvements. The City's portion of the funding will be provided through the use of State Aid funds. County staff and city staff have reviewed the plans, and comments have been incorporated. The County has requested that additional street lights be added for safety of the crossing. These additional poles for lighting would be wood poles similar to those on the east side of Powers Blvd. The pedestrian crossing signal poles will be the standard bronze painted steel poles similar to other signal systems in Chanhassen. Approval of the plans at this time will allow for early bidding and to provide the contractor with the necessary lead time in ordering the signal poles. Process time for signal poles can be 18 to 22 weeks. Also included with this project is a contract amendment with Bolton & Menk, Inc. for $5,500.00 due to wetland delineation work being required by Riley Purgatory Bluff Creek Watershed District and this work was not part of the original scope. PROPOSED SCHEDULE The current Schedule for the project is as follows: Approve Plans & Specifications November 12, 2019 MnDOT Plan Approval November 2019 Bidding December 2019 Bid Award January, 2020 Construction May 2020 October 2020 RECOMMENDATION Staff recommends adoption of the resolution approving the plans and specifications and authorizes the advertisement of bids for the Powers Boulevard/Lake Lucy Road Pedestrian Improvement project. Also, to approve the contract amendment to the consultant contract with Bolton & Menk, Inc. in the amount of $5,500.00. ATTACHMENTS: Resolution Cost Estimate CIP Sheet Overview Title Sheet Signal Pole Type Professional Services Agreement with Bolton & Menk Contract Amendment CITY OF CHANHASSEN CARVER AND HENNEPIN COUNTIES, MINNESOTA DATE: November 12, 2019 RESOLUTION NO: 2019-XX MOTION BY: SECONDED BY: A RESOLUTION APPROVING PLANS AND SPECIFICATIONS AND AUTHORIZING AD FOR BIDS FOR THE POWERS BOULEVARD/LAKE LUCY ROAD PEDESTRIAN PROJECT NO. PW31a WHEREAS, the City Engineer’s project consultant has prepared plans and specifications for the Powers Boulevard/Lake Lucy Road Pedestrian Improvement Project and has presented such plans and specifications to the Council for approval. NOW THEREFORE, BE IT RESOLVED that the Chanhassen City Council: 1. Such plans and specifications, a copy of which can be reviewed at the office of the City Engineer, are hereby approved. 2. The city clerk shall prepare and cause to be inserted in the official newspaper and QuestCDN, an advertisement for bids upon the making of such improvement under such approved plans and specifications. The ad shall be published at least three times, shall specify the work to be done, shall state that bids will be opened and that the responsibility of the bidders will be considered by the Council at a future City Council meeting, in the Council Chambers of the City Hall. Any bidder whose responsibility is questioned during consideration of the bid will be given the opportunity to address the Council on the issue of responsibility. No bids will be considered unless sealed and filed with the clerk and accompanied by a bid security payable to the clerk for 5% of the amount of such bid. Passed and adopted by the Chanhassen City Council this 12th day of November, 2019. ATTEST: Todd Gerhardt, City Manager Elise Ryan, Mayor YES NO ABSENT CARVER COUNTY CARVER COUNTY CITY OF CHANHASSEN CITY OF CHANHASSEN ESTIMATED ROADWAY ROADWAY ROADWAY ROADWAY ITEM MNDOT UNIT TOTAL TOTAL NEEDS ELIGIBLE NEEDS INELIGIBLE NEEDS ELIGIBLE NEEDS INELIGIBLE NO.SPEC NO.BID ITEM NOTES UNIT PRICE QUANTITY COST QUANTITY COST QUANTITY QUANTITY QUANTITY COST QUANTITY COST QUANTITY QUANTITY QUANTITY COST QUANTITY COST 1 2011.601 AS BUILTS LUMP SUM $300.00 1 $300.00 0.5 $150.00 0.5 0.5 $150.00 0.5 2 2021.501 MOBILIZATION LUMP SUM $30,000.00 1 $30,000.00 0.5 $15,000.00 0.5 0.5 $15,000.00 0.5 3 2101.524 CLEARING TREE $500.00 1 $500.00 0.5 $250.00 0.5 0.5 $250.00 0.5 4 2101.524 GRUBBING TREE $750.00 1 $750.00 0.5 $375.00 0.5 0.5 $375.00 0.5 5 2102.503 PAVEMENT MARKING REMOVAL (STRIPING)LIN FT $1.00 4500 $4,500.00 2250 $2,250.00 2250 2250 $2,250.00 2250 6 2102.518 PAVEMENT MARKING REMOVAL (SYMBOL)SQ FT $4.00 714 $2,856.00 357 $1,428.00 357 357 $1,428.00 357 7 2104.502 REMOVE HYDRANT EACH $1,500.00 1 $1,500.00 1 $1,500.00 8 2104.502 REMOVE TANGENT TERMINAL EACH $500.00 2 $1,000.00 1 $500.00 1 1 $500.00 1 9 2104.502 SALVAGE SIGN EACH $250.00 11 $2,750.00 5 $1,250.00 5 6 $1,500.00 6 10 2104.502 SALVAGE MAILBOX EACH $150.00 3 $450.00 3 $450.00 3 11 2104.503 REMOVE CONCRETE CURB AND GUTTER LIN FT $8.00 580 $4,640.00 290 $2,320.00 290 290 $2,320.00 290 12 2104.503 REMOVE GUARDRAIL LIN FT $10.00 900 $9,000.00 450 $4,500.00 450 450 $4,500.00 450 13 2104.503 REMOVE HANDRAIL [2]LIN FT $5.00 240 $1,200.00 120 $600.00 120 120 $600.00 120 14 2104.503 REMOVE SEWER PIPE (STORM)[2] [3]LIN FT $100.00 30 $3,000.00 15 $1,500.00 15 $1,500.00 15 2104.503 REMOVE RETAINING WALL [5]LIN FT $40.00 240 $9,600.00 120 $4,800.00 120 120 $4,800.00 120 16 2104.504 REMOVE BITUMINOUS TRAIL [1]SQ YD $8.00 600 $4,800.00 300 $2,400.00 300 300 $2,400.00 300 17 2104.504 REMOVE BITUMINOUS PAVEMENT [1]SQ YD $5.00 1240 $6,200.00 620 $3,100.00 620 620 $3,100.00 620 18 2104.518 REMOVE CONCRETE WALK [1]SQ FT $2.00 350 $700.00 175 $350.00 175 175 $350.00 175 19 2105.507 COMMON EXCAVATION (EV) (P)[P]CU YD $18.00 1425 $25,650.00 725 $13,050.00 725 700 $12,600.00 700 20 2118.509 AGGREGATE SURFACING, CLASS 2 TON $35.00 55 $1,925.00 30 $1,050.00 30 25 $875.00 25 21 2211.509 AGGREGATE BASE (CV), CLASS 4 TON $22.00 1560 $34,320.00 780 $17,160.00 780 780 $17,160.00 780 22 2211.509 AGGREGATE BASE (CV), CLASS 5 TON $22.00 850 $18,700.00 425 $9,350.00 425 425 $9,350.00 425 23 2232.504 MILL BITUMINOUS SURFACE (1.5")SQ YD $1.10 1940 $2,134.00 970 $1,067.00 970 970 $1,067.00 970 24 2360.509 TYPE SP 9.5 WEAR COURSE MIXTURE (2,B)TON $75.00 1000 $75,000.00 500 $37,500.00 500 500 $37,500.00 500 25 2402.503 PIPE RAILING LIN FT $50.00 220 $11,000.00 110 $5,500.00 110 110 $5,500.00 110 26 2411.618 MODULAR BLOCK RETAINING WALL SQ FT $40.00 1600 $64,000.00 800 $32,000.00 800 800 $32,000.00 800 27 2501.502 15" RC PIPE APRON EACH $800.00 2 $1,600.00 1 $800.00 1 1 $800.00 1 28 2501.503 15" RC PIPE SEWER DES 3006 CL V LIN FT $55.00 398 $21,890.00 199 $10,945.00 199 199 $10,945.00 199 29 2504.602 INSTALL HYDRANT LEAD EACH $3,500.00 1 $3,500.00 1 $3,500.00 30 2506.502 ADJUST GATE VALVE AND BOX EACH $250.00 3 $750.00 3 $750.00 31 2506.502 FURNISH AND INSTALL CASTING ASSEMBLY (STORM)EACH $800.00 7 $5,600.00 4 $3,200.00 3 $2,400.00 32 2506.503 CONSTRUCT DRAINAGE STRUCTURE DESIGN 4020 LIN FT $425.00 15.13 $6,430.25 7.13 $3,030.25 8 $3,400.00 33 2506.503 CONSTRUCT DRAINAGE STRUCTURE DESIGN 4022 LIN FT $425.00 21.64 $9,197.00 11 $4,675.00 10.64 $4,522.00 34 2506.503 CONSTRUCT DRAINAGE STRUCTURE DESIGN H LIN FT $425.00 9.6 $4,080.00 4.8 $2,040.00 4.8 $2,040.00 35 2511.507 RANDOM RIPRAP CLASS III CU YD $100.00 15 $1,500.00 8 $800.00 7 $700.00 36 2521.518 4" CONCRETE WALK SQ FT $6.00 495 $2,970.00 250 $1,500.00 250 245 $1,470.00 245 37 2521.518 6" CONCRETE WALK SQ FT $8.00 995 $7,960.00 500 $4,000.00 500 495 $3,960.00 495 38 2521.518 TRUNCATED DOMES SQ FT $65.00 118 $7,670.00 59 $3,835.00 59 59 $3,835.00 59 39 2531.503 CONCRETE CURB AND GUTTER, DESIGN B424 LIN FT $15.00 1675 $25,125.00 840 $12,600.00 840 835 $12,525.00 835 40 2540.502 INSTALL SALVAGED MAILBOX EACH $200.00 3 $600.00 3 $600.00 3 41 2554.502 END TREATMENT-TANGENT TERMINAL EACH $3,500.00 2 $7,000.00 1 $3,500.00 1 1 $3,500.00 1 42 2554.503 TRAFFIC BARRIER, DESIGN B8338 LIN FT $25.00 800 $20,000.00 400 $10,000.00 400 400 $10,000.00 400 43 2564.501 TRAFFIC CONTROL LUMP SUM $15,000.00 1 $15,000.00 0.5 $7,500.00 0.5 0.5 $7,500.00 0.5 44 2564.502 INSTALL SALVAGED SIGN EACH $300.00 11 $3,300.00 5 $1,500.00 5 6 $1,800.00 6 45 2564.502 INSTALL SIGN PANEL TYPE C EACH $400.00 2 $800.00 1 $400.00 1 1 $400.00 1 46 2564.502 INSTALL OBJECT MARKER TYPE X4-2 EACH $400.00 2 $800.00 1 $400.00 1 1 $400.00 1 47 2565.616 PEDESTRIAN CROSSWALK FLASHER SYSTEM SYSTEM $81,000.00 1 $81,000.00 0.5 $40,500.00 0.5 0.5 $40,500.00 0.5 48 2573.502 STORM DRAIN INLET PROTECTION EACH $250.00 7 $1,750.00 4 $1,000.00 4 3 $750.00 3 49 2573.503 SEDIMENT CONTROL LOG, TYPE STRAW LIN FT $3.00 250 $750.00 125 $375.00 125 125 $375.00 125 50 2573.503 SILT FENCE, TYPE HAND INSTALLED LIN FT $3.00 990 $2,970.00 495 $1,485.00 495 495 $1,485.00 495 51 2574.507 COMMON TOPSOIL BORROW (LV)CU YD $35.00 200 $7,000.00 100 $3,500.00 100 100 $3,500.00 100 52 2575.604 TURF REINFORCEMENT MAT (CATEGORY 4)[6]SQ YD $12.00 1400 $16,800.00 700 $8,400.00 700 700 $8,400.00 700 53 2575.604 EROSION CONTROL BLANKET (CATEGORY 3N)[7]SQ YD $3.00 1400 $4,200.00 700 $2,100.00 700 700 $2,100.00 700 54 2581.503 REMOVABLE PREFORMED PAVEMENT MARKING TAPE LIN FT $2.00 6470 $12,940.00 3235 $6,470.00 3235 3235 $6,470.00 3235 55 2582.503 24" SOLID LINE PAINT LIN FT $9.00 500 $4,500.00 250 $2,250.00 250 250 $2,250.00 250 56 2582.503 4" DOUBLE SOLID LINE PAINT LIN FT $0.50 2100 $1,050.00 1050 $525.00 1050 1050 $525.00 1050 57 2582.503 6" SOLID LINE PAINT LIN FT $0.25 2900 $725.00 1450 $362.50 1450 1450 $362.50 1450 58 2582.518 PAVEMENT MESSAGE - MULTI-COMPONENT SQ FT $10.00 134 $1,340.00 67 $670.00 67 67 $670.00 67 59 2582.518 CROSSWALK MARKING - MULTI-COMPONENT SQ FT $7.00 360 $2,520.00 180 $1,260.00 180 180 $1,260.00 180 TOTAL CONSTRUCTION COST $599,792.25 $282,877.50 $15,245.25 $281,357.50 $14,562.00 $5,750.00 DESIGN, ADMINISTRATION & CONSTRUCTION ENGINEERING $100,000.00 $47,162.58 $2,541.76 $46,909.16 $2,427.84 $958.66 TOTAL PROJECT COST $699,792.25 $330,040.08 $17,787.01 $328,266.66 $16,989.84 $6,708.66 [3] REMOVAL OF PIPE APRONS SHALL BE CONSIDERED INCIDENTAL [4] AS DETERMINED IN THE FIELD BY THE ENGINEER [7] INCLUDES SEED MIX 25-141 & TYPE 3 FERTILIZER MASTER ESTIMATE CITY OF CHANHASSEN SAP 194-020-016 / SAP 010-617-024 BMI PROJECT NUMBER - C16.119073 11/1/2019 CITY OF CHANHASSEN NON-PARTICIPATING NOTES: [P] DENOTES PLAN QUANTITY (EV-EXCAVATED VOLUME; LV-LOOSE VOLUME; CV-COMPACTED VOLUME [1] ANY THICKNESS [2] ANY TYPE, ANY SIZE [5] HEIGHT RANGES FROM 2'-5' ABOVE GRADE [6] INCLUDES SEED MIX 35-241 & TYPE 3 FERTILIZER POWERS BOULEVARD & LAKE LUCY ROAD PEDESTRIAN IMPROVEMENTS CARVER COUNTY ROADWAY CARVER COUNTY STORM SEWER CITY OF CHANHASSEN ROADWAY PARTICIPATING - SAP 194-020-016 CITY OF CHANHASSEN STORM SEWER X X X X X X XXXXXXXX XC HSSSXXXXH:\CHAN\C16119073\CAD\C3D\MISC-LAYOUT-OVERVIEW.dwg 11/5/2019 11:46 AM RPowers Blvd & Lake Lucy Road Pedestrian ImprovementsCity of ChanhassenProject OverviewNovember 2019FEETSCALE050100HORZ.Lake Lucy RoadLake Lucy RoadPowers Blvd Powers Blvd Treetop RoadGolden CourtLegendRoadwayShoulderConcrete Curb,Median & Ped RampsTrailR TITLE SHEET SAP 194-020-016: SAP 010-617-024 MINNESOTA DEPARTMENT OF TRANSPORTATION CITY OF CHANHASSEN CARVER COUNTY, MINNESOTA POWERS BOULEVARD & LAKE LUCY ROAD PEDESTRIAN IMPROVEMENTS --- GOVERNING SPECIFICATIONS --- THE 2018 EDITION OF THE MINNESOTA DEPARTMENT OF TRANSPORTATION "STANDARD SPECIFICATION FOR CONSTRUCTION" SHALL GOVERN. Approved: City of Chanhassen Engineer Date Date Date Date Approved: Carver County Engineer District State Aid Engineer: Review for compliance with State Aid Rules/Policy Approved for State Aid Funding: State Aid Engineer BEGIN PROJECT: SAP 194-020-016: SAP 010-617-024 (POWERS BLVD) NB STA 101+51.59, SB STA 202+48.18 Andrew L. Budde, P.E. Design Engineer: I hereby certify that this plan was prepared by me or under my direct supervision, and that I am a duly Licensed Professional Engineer under the laws of the State of Minnesota. Date License Number11/5/2019 ALL TRAFFIC CONTROL DEVICES AND SIGNING SHALL CONFORM AND BE INSTALLED IN ACCORDANCE WITH THE "MINNESOTA MANUAL ON UNIFORM TRAFFIC CONTROL DEVICES" (MN MUTCD) AND PART VI, "FIELD MANUAL" FOR TEMPORARY TRAFFIC CONTROL DEVICES. PROJECT DATUM: CARVER COUNTY COORDINATES HORIZONTAL: NAD 83 ADJ. 1986 VERTICAL: NAVD 88 CONTRACTOR: OBSERVER: DATE: MH RIM STA 104+00, 55' L NEAR TREE TOP ROAD RECORD DRAWING INFORMATIONBM=1004.01 SHEET Bolton & Menk, Inc. 2019, All Rights ReservedcH:\CHAN\C16119073\CAD\C3D\119073C101.dwg 11/5/2019 12:01 PMDESIGNED DRAWN CHECKED CLIENT PROJ. NO. ISSUED FOR DATENO. R 2638 SHADOW LANE, SUITE 200 CHASKA, MINNESOTA 55318 Phone: (952) 448-8838 Email: Chaska@bolton-menk.com www.bolton-menk.com CITY OF CHANHASSEN POWERS BOULEVARD & LAKE LUCY ROAD PEDESTRIAN IMPROVEMENTS TED SCD ALB C16.119073 THE SUBSURFACE UTILITY INFORMATION IN THIS PLAN IS UTILITY QUALITY LEVEL D UNLESS OTHERWISE NOTED. THIS UTILITY LEVEL WAS DETERMINED ACCORDING TO THE GUIDELINES OF CI/ASCE 38-02, ENTITLED "STANDARD GUIDELINES FOR THE COLLECTION AND DEPICTION OF EXISTING SUBSURFACE UTILITY DATA." R CITY:CHANHASSEN COUNTY:CARVER DISTRICT:METR0 SHEET NO.INDEXSHEET DESCRIPTION (THIS PLAN SET CONTAINS 73 SHEETS) SECTION 1: GENERAL TITLE SHEET C1.01 LEGEND C1.02 GENERAL PLAN LAYOUT C1.03 STATEMENT OF ESTIMATED QUANTITIES C1.04 CONSTRUCTION & SOILS NOTES C1.05 QUANTITY TABULATIONS C1.06-C1.07 TYPICAL SECTIONS C1.08-C1.09 CONSTRUCTION DETAILS C1.10-C1.30 SECTION 2: ALIGNMENT PLAN C2.01 SECTION 3: EXISTING CONDITIONS & REMOVAL PLAN C3.01 SECTION 4: STORM SEWER PLAN & CONSTRUCTION PLAN C4.01-C4.07 SECTION 5: EROSION CONTROL & TURF ESTABLISHMENT PLAN C5.01-C5.04 SECTION 6: SIGNING & STRIPING PLAN C6.01-C6.09 SECTION 7: LIGHTING PLAN, RRFB C7.01-C7.07 SECTION 8: STAGING & DETOUR PLAN C8.01-C8.06 SECTION 9: CROSS SECTIONS C9.01-C9.07 2.0'3.5' SCALES:PLAN INDEX MAP GENERAL LAYOUT HEIGHT OF EYE HEIGHT OF OBJECT DESIGN DESIGNATION 0'500 0'25' 0'60' ALIGNMENT PLAN 0'60' 10 TON DESIGN APPROVED BYSHEET NUMBERDATE PLAN REVISIONS S.P. NUMBER ESALS (20) R VALUE ADT (CURRENT YEAR) 2020 ADT (FUTURE YEAR) 2040 PROJ. HCADT SHOULDER WIDTH (FT.) ROADWAY CLASSIFICATION NO. OF TRAFFIC LANES NO. OF PARKING LANES DESIGN SPEED (MPH): 12 13,500 15,500 5% 8 2 0 50 1,831,000 SAP 194-020-016 (CSAH 17) MINOR ARTERIAL POWERS BOULEVARD CONSTRUCTION PLANS FOR GRADING, BITUMINOUS PAVING, ROAD WIDENING, MEDIAN CONSTRUCTION, ADA IMPROVEMENTS & PEDESTRIAN CROSSING POWERS BOULEVARD SAP 194-020-016 (CSAH 17), SAP 010-617-024 (CSAH 17) GROSS LENGTH BRIDGES-LENGTH EXCEPTIONS-LENGTH NET LENGTH FEET FEET FEET FEET MILES MILES MILES MILES FROM TO PROJECT DATUM:CARVER COUNTY COORDINATES NOTE: LENGTHS AND DESCRIPTIONS ARE BASED ON LANE ALIGNMENTS END PROJECT: SAP 194-020-016: SAP 010-617-024 (POWERS BLVD) NB STA 115+68.05, SB STA 216+64.90 BASED ON STOPPING SIGHT DISTANCE CARVER BEACH ROAD DEVONSHIRE DRIVE 1,700 N/A N/A 0.32 N/A N/A 1,700 0.32 46585 SAP 010-617-024 (CSAH 17) TRAIL DESIGN DESIGNATION 0.0'4.5'HEIGHT OF EYE HEIGHT OF OBJECT DESIGN SPEED NOT ACHIEVED AT: N/A BASED ON STOPPING SIGHT DISTANCE DESIGN SPEED:20 MPH C1.01 OF 73 PROFESSIONAL SERVICES AGREEMENT AGREEMENT made this 10th day of June, 2019, by and between the CITY OF CHANHASSEN, a Minnesota municipal corporation ("City"; and Bolton & Menk, [nc. ("Consultant"). IN CONSIDERATION OF THEIR MUTUAL COVENANTS, THE PARTIES AGREE AS FOLLOWS: 1. SCOPE OF SERVICES. The City retains Consultant for Powers Boulevard/Lake Lucy Road Pedestrian Improvements. 2. CONTRACT DOCUMENTS. The following documents shall be referred to as the "Contract Documents," all of which shall be taken together as a whole as the contract between the parties as if they were set verbatim and in full herein: This Professional Services Agreement; Request for quote - Via phone call on May 17,2019; lnsurance Certificate; Consultant's May 21,2019 proposal for Powers Boulevard/Lake Lucy Road Pedestrian Improvements ("Proposal"). A. B. C. D. I 201749v1 In the event of conflict among the provisions of the Contract Documents, the order in which they are listed above shall control in resolving any such conflicts, with Contract Document "A" having the first priority and Contract Document "D" having the last priority. 3. COMPENSATION. Consultant shall be paid by the City for the services described in the Proposal a not to exceed fee of Eighty-Five Thousand, Four Hundred Fifty Dollars ($85,450, inclusive of expenses. Services performed directly by Consultant shall be paid at an hourly rate in accordance with the Proposal, subject to the not to exceed fee. The not to exceed fees and expenses shall not be adjusted if the estimated hours to perform a task, the number of required meetings, or any other estimate or assumption is exceeded. Consultant shall bill the City as the work progresses. Pa5rment shall be made by the City within thirty-five (35) days of receipt of an invoice. 4. DOCUMENT OWNERSHIP. All reports, plans, models, diagrams, analyses, and information generated in connection with performance of this Agreement shall be the property of the City. The City may use the information for its purposes. 5. CHANGE ORDERS. All change orders, regardless of amount, must be approved in advance and in writing by the City. No payment will be due or made for work done in advance ofsuch approval. 6. COMPLIANCE WITH LAWS AND REGULATIONS. In providing services hereunder, Consultant shall abide by all statutes, ordinances, rules and regulations pertaining to the provisions of services to be provided. 7. STANDARD OF CARE. Consultant shall exercise the same degree of care, skill, and diligence in the performance of the services as is ordinarily possessed and exercised by a professional consultant under similar circumstances. No other warranty, expressed or implied, is included in this Agreement. City shall not be responsible for discovering deficiencies in the accuracy of Consultant's services. 8. INDEMNIFICATION. Consultant shall indemnify and hold harmless the City, its officers, agents, and employees, of and from any and all claims, demands, actions, causes of action, including costs and attorney's fees, arising out of or by reason of the execution or performance of the services provided for herein and further agrees to defend at its sole cost and expense any action or proceeding commenced for the purpose of asserting any claim of whatsoever character arising hereunder. 9. INSURANCE. Consultant shall secure and maintain such insurance as will protect Consultant from claims under the Worker's Compensation Acts, automobile liability, and from claims for bodily injury death, or property damage which may arise from the performance of services under this Agreernent. Such insurance shall be written for amounts not less than: CommercialGeneralLiability S2,000,000eachoccurrencelaggegate Automobile Liability $2,000,000 combined single limit Professional Liability $2,000,000 each occurrence/aggregate The City shall be named as an additional insured on the general liability policy on a primary and non- contributory basis. Before commencing work, the Consultant shall provide the City a certificate of insurance evidencing the required insurance coverage in a form acceptable to City. 10. INDEPENDENT CONTRACTOR. The City hereby retains Consultant zN an independent contractor upon the terms and conditions set forth in this Agreernent. Consultant is not an employee of the City and is free to contract with other entities as provided herein. Consultant shall be responsible for selecting the means and methods of performing the work. Consultant shall fumish any and all supplies, equipment, and incidentals necessary for Consultant's performance under this Agreernent. City and Consultant agree that Consultant shall not at any time or in any manner represent that Consultant or any of Consultant's agents or employees are in any manner agents or employees of the City. Consultant shall be exclusively responsible under this Agreement for Consultant's own FICA payments, workers compensation payments, unemployment compensation payments, withholding amounts, and/or self-ernployment taxes if any such payments, amounts, or taxes are required to be paid by law or regulation. 2 201749v1 11. SUBCONTRACTORS. Consultant shall not enter into subcontracts for seruices provided under this Agreement without the express written consent of the City. Consultant shall comply with Minnesota Statutes $ 471.425. Consultant must pay subcontractors for all undisputed services provided by subcontractors within ten (10) days of Consultant's receipt of payment from City. Consultant must pay interest of one and five-tenths percent (15%) per month or any part of a month to subcontractors on any undisputed amount not paid on time to subcontractors. The minimum monthly interest penalty payment for an unpaid balance of One Hundred Dollars ($100.00) or more is Ten Dollars ($10.00). 12. CONTROLLING LAWVENUE. This Agreement shall be governed by and construed in accordance with the laws of the State of Minnesota. In the event of litigation, the exclusive venue shall be in the District Court of the State of Minnesota for Carver County Minnesota. 13. MINNESOTA C,OYERNMENT DATA PRACTICES ACT. Consultant must comply with the Minnesota Govemment Data Practices Act, Minnesota Statutes Chapter 13, as it applies to (1) all data provided by the City pursuant to this Agreement, and (2) all dat4 created, collected, received, stored, used, maintained, or disseminated by Consultant pursuant to this Agreement. Consultant is subject to all the provisions of the Minnesota Govemment Data Practices Act, including but not limited to the civil remedies of Minnesota Statutes Section 13.08, as if it were a govemment entity. In the event Consultant receives a request to release data, Consultant must immediately notifu City. City will give Consultant instructions concerning the release of the data to the requesting party before the data is released. Consultant agrees to defend, indemnit/, and hold City, its officials, officers, agents, employees, and volunteers harmless from any claims resulting from Consultant's officers', agents', city's, parfiters', employees', volunteers', assignees' or subcontractors' unlawful disclosure and/or use of protected data. The terms of this paragraph shall survive the cancellation or termination of this Agreement. 14. COPYRIGHT. Consultant shall defend actions or claims charging infringement of any copyright or software license by reason of the use or adoption of any software, designs, drawings or specifications supplied by it, and it shall hold harmless the City from loss or damage resulting therefrom. 15. PATENTED DEVICES, MATERIALS AND PROCESSES. If the Contract requires, or the Consultant desires, the use of any design, devise, material or process covered by letters, patent or copyright, trademark or trade name, the Consultant shall provide for such use by suitable legal agreement with the patentee or owner and a copy of said agreement shall be filed with the City. If no such agreement is made or filed as noted, the Consultant shall indemnifu and hold harmless the City from any and all claims for infringement by reason of the use of any such patented designed, device, material or process, or any trademark or trade name or copyright in connection with the services agreed to be performed under the Contract, and shall indemniff and defend the City for any costs, liability, expenses and attorney's fees that result from any such infringement. J 201749v1 16. RECORDS. Consultant shall maintain complete and accurate records of hours worked and expenses involved in the performance of services. 17. ASSIGNMENT. Neither party shall assign this Agreonent, or any interest arising herein, without the written consent of the other party. 18. WAMR. Any waiver by either party of a breach of any provisions of this Agreement shall not affect, in any respect, the validity of the remainder of this Agreement. 19. ENTIRE AGREEMENT. The entire agreement of the parties is contained herein. This Agreement supersedes all oral agreements and negotiations between the parties relating to the subject matter hereof, as well as any previous agreements presently in effect between the parties relating to the subject matter hereof. Any alterations, amendments, deletions, or waivers of the provisions of this Agreement shall be valid only when expressed in writing and duly signed by the parties, unless otherwise provided herein. 20. TERMINATION. This Agreernent may be terminated by the City for any reason or for convenience upon written notice to the Consultant. In the event of termination, the City shall be obligated to the Consultant for payment of amounts due and owing including payment for services performed or furnished to the date and time of termination. Dated:{rnr tb . 2oB cITYoFCHANHASSEN Dated:204 CONSULTANT BOLTON & MENK, INC. 2638 Lane, Suite 200 Chaska, BY: 553 1 72 Budde, P.E Project Manager BY BY Gerhardt, City Manager 4 201749v1 H:\CHAN\C16119073\0_Powers Blvd and Lake Lucy Rd Pedestrian Improvements\A_Project Management\Additional Fee Request - Wetland Delineation.docx November 4, 2019 Bruce Loney Public Works Director/City Engineer 7700 Market Blvd PO Box 147 Chanhassen, MN 55317 RE: Powers Blvd/Lake Lucy Rd Pedestrian Improvements Dear Mr. Loney: On June 10, 2019 Bolton & Menk and the City of Chanhassen entered into a Professional Services Agreement for the design and construction administration of Powers Blvd/Lake Lucy Rd Pedestrian Improvements in the amount of $85,450. Among the tasks included were topographic survey, project management & coordination, right of way determination, final design, and construction services. The proposal did not include a wetland delineation and report. However, the Minnehaha Creek Watershed District is requiring a wetland delineation and report to be completed as part of the permitting process to ensure adjacent wetlands are protected during construction. The construction limits are intended to keep a separation distance of approximately 20 feet from the wetlands and no impacts should occur to the wetland. The additional effort to complete the wetland delineation and report is estimated to be $5,500. The wetland delineation and report will be completed in a timely manner, allow permits to be acquired for the project, and for construction to begin as scheduled in 2020. Sincerely, Bolton & Menk, Inc. Andrew Budde Project Manager Accepted: City of Chanhassen_____________ By:___________________________________ Date:_________________________________ Title:__________________________________ CITY COUNCIL STAFF REPORT Tuesday, November 12, 2019 Subject Approve Pioneer Pass Park Recreational Skating Rink Section CONSENT AGENDA Item No: D.6. Prepared By Jerry Ruegemer, Recreation Superintendent File No: RA332 PROPOSED MOTION "The City Council approves a recreational ice skating rink at Pioneer Pass Park on a temporary basis for the 2019/2020 outdoor ice skating season." Approval requires a Simple Majority Vote of members present. BACKGROUND At the August 27, 2019 Park and Recreation Commission meeting, the commission reviewed and recommended approval of the 2019/2020 ice skating rink locations as presented by staff. Also at the August meeting, neighborhood representatives from Pioneer Pass requested a skating rink at Pioneer Pass Park for the 2019/2020 skating season. After discussing the validity of establishing a rink, the Park and Recreation Commission requested staff provide budgetary numbers to complete this request to offer a recreational rink. At the October 22, 2019 Park and Recreation Commission meeting, staff provided the commission the budgetary information they requested to create the temporary rink for the 2019/2020 season. The commission discussed the $1,800 cost estimate and all voted in favor recommending approval to the City Council. DISCUSSION The recreational rink would be flooded on top of the existing ball field and would not have hockey boards, lights, a warming house, or attendants. The rink would be offered on a trial basis and usage would be monitored throughout the season to determine the location's viability in following years. The additional rink at Pioneer Pass Park would have minimal expenses and is estimated to cost $1,800 for the 2019/2020 season. This budgetary number includes all park maintenance costs and will be covered in the (1550) Park Maintenance Budget. RECOMMENDATION The Park and Recreation Commission recommends approval to the City Council for a recreational ice skating rink at Pioneer Pass Park on a temporary basis for the 2019/2020 outdoor ice skating season. CITY COUNCIL STAFF REPORT Tuesday, November 12, 2019 Subject Resolution 2019XX: Accept Bids Procured through Construction Cooperation Agreement with the Metropolitan Council Environmental Services and Award Contract for Construction of Cured InPlace Pipe Project #1902 Section CONSENT AGENDA Item No: D.7. Prepared By Erik Henricksen, Project Engineer File No: Project No. 1902 PROPOSED MOTION “The City Council approves the bid by VisuSewer for the city's portion of work in the amount of $240,500.00 in accordance with the Cooperative Construction Agreement with the Metropolitan Council Environmental Services (MCES) for project #1902." Approval requires a Simple Majority Vote of members present. BACKGROUND The MCES monitors the flow of sanitary sewer from each city to determine the amount of inflow and infiltration (I/I) to their treatment plant. If a city exceeds the allowance set by the Metropolitan Council, the city is surcharged a fee based on the amount of flow above the allowed amount. The project is similar to last year’s project but tailored to the areas identified to be addressed this year, and as the MCES will be conducting their own sewer rehabilitation on their trunk line near the city's planned work, staff has elected to partner with the MCES to reduce conflict with construction management and save on cost with economy of scale. DISCUSSION The MCES and the City of Chanhassen are undertaking similar sanitary sewer projects west of Galpin Boulevard and Majestic Way for both sanitary sewer infrastructure improvements and infiltration and inflow abatement. The MCES plans to rehabilitate their trunk line (interceptor 8253328) by installing cured inplace pipe liners and fiberglass manhole inserts, and the city plans to rehabilitate a 12inch concrete sanitary sewer that connects to the MCES trunk line by installing cured inplace pipe liners and rehabilitate 3 manholes inundated by a surrounding wetland. Both the city and the MCES desire that the city project be constructed in conjunction with the MCES project to minimize community impacts, while the city should see a reduction in cost due to economy of scale. The Agreement between the city and the MCES describes the responsibilities of each for the design and construction of the city portion of the project. The city appoints the MCES as its agent to obtain bids, enter into a contract for the construction of the work, and supervise the work performed on the city project for compliance with the city project construction documents and the Agreement. The project bid opening was on October 8, 2019. Four bids were received. VisuSewer submitted the low bid for CITY COUNCIL STAFF REPORTTuesday, November 12, 2019SubjectResolution 2019XX: Accept Bids Procured through Construction Cooperation Agreement withthe Metropolitan Council Environmental Services and Award Contract for Construction of CuredInPlace Pipe Project #1902SectionCONSENT AGENDA Item No: D.7.Prepared By Erik Henricksen, Project Engineer File No: Project No. 1902PROPOSED MOTION“The City Council approves the bid by VisuSewer for the city's portion of work in the amount of $240,500.00 inaccordance with the Cooperative Construction Agreement with the Metropolitan Council Environmental Services(MCES) for project #1902."Approval requires a Simple Majority Vote of members present.BACKGROUNDThe MCES monitors the flow of sanitary sewer from each city to determine the amount of inflow and infiltration (I/I) totheir treatment plant. If a city exceeds the allowance set by the Metropolitan Council, the city is surcharged a feebased on the amount of flow above the allowed amount. The project is similar to last year’s project but tailored to theareas identified to be addressed this year, and as the MCES will be conducting their own sewer rehabilitation on theirtrunk line near the city's planned work, staff has elected to partner with the MCES to reduce conflict with constructionmanagement and save on cost with economy of scale.DISCUSSIONThe MCES and the City of Chanhassen are undertaking similar sanitary sewer projects west of Galpin Boulevard andMajestic Way for both sanitary sewer infrastructure improvements and infiltration and inflow abatement. The MCESplans to rehabilitate their trunk line (interceptor 8253328) by installing cured inplace pipe liners and fiberglassmanhole inserts, and the city plans to rehabilitate a 12inch concrete sanitary sewer that connects to the MCES trunkline by installing cured inplace pipe liners and rehabilitate 3 manholes inundated by a surrounding wetland. Both thecity and the MCES desire that the city project be constructed in conjunction with the MCES project to minimizecommunity impacts, while the city should see a reduction in cost due to economy of scale.The Agreement between the city and the MCES describes the responsibilities of each for the design and constructionof the city portion of the project. The city appoints the MCES as its agent to obtain bids, enter into a contract for theconstruction of the work, and supervise the work performed on the city project for compliance with the city projectconstruction documents and the Agreement. The project bid opening was on October 8, 2019. Four bids were received. VisuSewer submitted the low bid for the MCES portion of work, which controlled the award as MCES was the "base bid". VisuSewer's bid was $240,500.00 for the city's portion of work. The bid results for the city's portion of work are as follows: Contractor Total Bid Amount VisuSewer $240,500.00* Insituform $239,157.70 Michels Pipe Services $253,455.00 Minger Construction $289,780.00 *Does not include 7% engineering services ($16,835) from the cooperative agreement, see attached "Exhibit B" for all inclusive cost. The Design Engineer's estimate provided to the city was $112,350.00. The discrepancy between the Design Engineer's estimate and the bidder's was due to underestimating the scope of work within the wetland. Manholes were discovered to be inundated by wetlands towards the end of the design process, requiring their rehabilitation and subsequent raising above the wetlands' ordinary high water level. Furthermore, it was anticipated that "biologs" would be utilized for erosion control; however, the watershed district will require "jbarrier" silt fence, an erosion control measure with significantly higher costs, both in labor and materials. As such, bids were 110% higher than the estimate, however VisuSewer's bid is 6% (or $15,223.18) below the average of the bidders. After thorough review of the bids, and followup conversations with MCES's design engineers and bidders, staff finds the bids to be reasonable and acceptable. VisuSewer has completed work in Chanhassen in the past and their work was acceptable. Funding for the project is proposed from the Sanitary Sewer Utility Fund and was budgeted in the 2019 CIP under Project # SS012. The work is defined to be substantially completed by May 1, 2020. RECOMMENDATION Staff recommends the Council approve VisuSewer's bid in the amount of $240,500.00 and allow MCES to award a construction contract for the city's portion of work for the 2019 Sanitary Sewer I&I Project #1902. ATTACHMENTS: Bid Tabulation and Comparison Project Area Map Construction Cooperation Agreement for Construction of Cured InPlace Pipe in Chanhassen, MN CIP Sheet Exhibit B Resolution Prepared by Henricksen, Erik 11/6/2019 Page 1 Avgerage Average Item Description Estimated Unit Total Unit Total Unit Total Unit Total Unit Total Unit Total #Quantity Units Price Price Price Price Price Price Price Price Price Price Price Price 1 Erosion Control - City 2200 LF $4.00 $8,800.00 $22.00 $48,400.00 $21.20 $46,640.00 $21.00 $46,200.00 $20.50 $45,100.00 $21.18 $46,585.00 2 Final CCTV Televising - City 1100 LF $5.00 $5,500.00 $1.00 $1,100.00 $3.10 $3,410.00 $3.10 $3,410.00 $1.15 $1,265.00 $2.09 $2,296.25 3 Sanitary Pipe Cleaning & Disposal - City 1100 LF $3.00 $3,300.00 $1.00 $1,100.00 $4.10 $4,510.00 $4.00 $4,400.00 $2.25 $2,475.00 $2.84 $3,121.25 4 12" CIPP Lining - City 1100 LF $50.00 $55,000.00 $56.00 $61,600.00 $32.00 $35,200.00 $46.50 $51,150.00 $64.15 $70,565.00 $49.66 $54,628.75 5 Wetland Work & Restoration 1 LS $10,000.00 $10,000.00 $94,500.00 $94,500.00 $93,233.10 $93,233.10 $93,000.00 $93,000.00 $85,000.00 $85,000.00 $91,433.28 $91,433.28 6 Chemical Grouting - City 25 GAL $60.00 $1,500.00 $100.00 $2,500.00 $259.00 $6,475.00 $232.00 $5,800.00 $75.00 $1,875.00 $166.50 $4,162.50 7 Manhole Rehabilitation - City 3 EA $3,500.00 $10,500.00 $4,600.00 $13,800.00 $4,537.30 $13,611.90 $4,515.00 $13,545.00 $4,500.00 $13,500.00 $4,538.08 $13,614.23 8 Temporary Conveyance 1 LS $15,000.00 $15,000.00 $12,500.00 $12,500.00 $31,077.70 $31,077.70 $30,950.00 $30,950.00 $65,000.00 $65,000.00 $34,881.93 $34,881.93 9 Allow for Restoration of Private Improvements 1 ALLOWANCE $5,000.00 $5,000.00 $5,000.00 $5,000.00 $5,000.00 $5,000.00 $5,000.00 $5,000.00 $5,000.00 $5,000.00 $5,000.00 $5,000.00 TOTALS $114,600.00 $240,500.00 $239,157.70 $253,455.00 $289,780.00 $255,723.18 19-02 - BID EVALUATION Bid Tabulation and Comparison Visu-Sewer InsituformEngineer's Estimate Michels Pipe Mienger Prepared by Henricksen, Erik 11/6/2019 Page 2 19-02 - BID EVALUATION Close Up Comparison for:Visu-Sewer Engineer's Estimate Avgerage Average Visu-Sewer Difference From Average Bid Item Description Estimated Unit Total Unit Total Unit Total Unit Price Total Price Unit Price Total Price #Quantity Units Price Price Price Price Price Price $$%$$% 1 Erosion Control - City 2200 LF $4.00 $8,800.00 $21.18 $46,585.00 $22.00 $48,400.00 $18.00 $39,600.00 450.0%$0.82 $1,815.00 3.9% 2 Final CCTV Televising - City 1100 LF $5.00 $5,500.00 $2.09 $2,296.25 $1.00 $1,100.00 -$4.00 -$4,400.00 -80.0%-$1.09 -$1,196.25 -52.1% 3 Sanitary Pipe Cleaning & Disposal - City 1100 LF $3.00 $3,300.00 $2.84 $3,121.25 $1.00 $1,100.00 -$2.00 -$2,200.00 -66.7%-$1.84 -$2,021.25 -64.8% 4 12" CIPP Lining - City 1100 LF $50.00 $55,000.00 $49.66 $54,628.75 $56.00 $61,600.00 $6.00 $6,600.00 12.0%$6.34 $6,971.25 12.8% 5 Wetland Work & Restoration 1 LS $10,000.00 $10,000.00 $91,433.28 $91,433.28 $94,500.00 $94,500.00 $84,500.00 $84,500.00 845.0%$3,066.73 $3,066.73 3.4% 6 Chemical Grouting - City 25 GAL $60.00 $1,500.00 $166.50 $4,162.50 $100.00 $2,500.00 $40.00 $1,000.00 66.7%-$66.50 -$1,662.50 -39.9% 7 Manhole Rehabilitation - City 3 EA $3,500.00 $10,500.00 $4,538.08 $13,614.23 $4,600.00 $13,800.00 $1,100.00 $3,300.00 31.4%$61.93 $185.78 1.4% 8 Temporary Conveyance 1 LS $15,000.00 $15,000.00 $34,881.93 $34,881.93 $12,500.00 $12,500.00 -$2,500.00 -$2,500.00 -16.7%-$22,381.93 -$22,381.93 -64.2% 9 Allow for Restoration of Private Improvements 1 LLOWANC $5,000.00 $5,000.00 $5,000.00 $5,000.00 $5,000.00 $5,000.00 TOTALS $114,600.00 $255,723.18 $240,500.00 $125,900.00 109.9%-$15,223.18 -6.0% Difference from Engr Estimate THE COUNCIL PROJECTMICHAEL J GORRAPRINCE R NELSONPRINCE R NELSONPRINCE R NELSONPRINCE R NELSONJ & C TIETZTRUSTSPAISLEY PARKENTERPRISEST & ETREATCHANHASSEN CITYMICHAEL J GORRAMH43MH44MH45MH46MH48MH47MH49MH50MH51MH52MH53MH54MH54AMH42MH16060MH16059MH21080MH21077MH21078MH21079MH21069MH16063MAJESTIC WAYWINDMILL DR CO R D N O . 1 1 7 ( G A L P I N B O U L E V A R D )THE COUNCIL PROJECTTHE CITYPROJECTTHE CITYPROJECTPRELIMINARY NOT FORCONSTRUCTION01" = 200' (HORIZONTAL)200'400'GENERAL NOTES:1.THE COUNCIL PROJECTSTARTS AT MH54 & RUNS WITHMCES INTERCEPTOR 8253-328TO MH44.2.THE CITY PROJECT STARTSLINING AT MH21078 & RUNS TOITS JUNCTION WITH MCESINTERCEPTOR 8253-328.3.THE COUNCIL PROJECT & THECITY PROJECT CONNECT ATMCES MH46.FIG-1CHANHASSEN INTERCEPTOR REHABILITATION 8253-328PROJECT SCOPE802883ADAM R. SALOXX/XX/1945107ARSJJCXX/XX/19KJAISSUED FOR BIDDING3/8/2019 8:51:24 AM 802883-SCOPE3/8/2019 8:51:45 AM ARSJ:\2018\20180012.04\CAD\PRELIM\802883-SCOPE.DWG ----TSREVISIONSDATEN0BYREMARKSDATEN0REVISIONSBYREMARKSCHECKEDDRAWNDESIGNEDPROFESSIONAL UNDER THE LAWS OF THE STATE OF MINNESOTA.BY ME OR UNDER MY DIRECT SUPERVISION AND THAT I AM A DULY LICENSEDI HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORT WAS PREPAREDDATEREG NOMODIFIED:TYPED OR PRINTED NAME:SIGNATURE:FILE NAMEPROJECTPLOTTED:OF Metropolitan Council No. 191014 CONSTRUCTION COOPERATION AGREEMENT FOR CONSTRUCTION OF CURED IN-PLACE PIPE IN CHANHASSEN, MN THIS AGREEMENT is made and entered into by and between the Metropolitan Council, a public corporation and political subdivision of the State of Minnesota ("Council"}, and the City of Chanhassen, a municipal corporation under the laws of the State of Minnesota ("City"). BACKGROUND RECITALS I. The Council plans to rehabilitate interceptor 8253-328 between manholes 54 and 45 by installing cured in-place pipe liners and fiberglass manhole inserts, during the 2020 construction season ("the Council Project"). 2. To avoid additional disruption to the community, the City desires to rehabilitate its 12-inch concrete sanitary sewer from manhole 5 to the connection to the Council's manhole 46 as · referenced on the City's record plan of project number 92-05 ("the City Project"). 3. Both Council and City desire that the City Project be constructed in conjunction with the Council Project to minimize community impacts. 4. The City is not staffed or equipped to construct the City Project during the 2020 construction season. 5. Therefore, the City desires to have the Council construct the City Project contemporaneously with the Council Project. NOW, THEREFORE, for mutual consideration, the receipt and sufficiency of which is hereby acknowledged by the parties, the parties agree as follows: AGREEMENT I. Purpose of Agreement 1. This Agreement describes the responsibilities of each of the Parties for design and construction of the City Project. 2. The City appoints the Council as its agent to obtain bids, enter into a contract for the construction of the work, and supervise the work performed on the City Project for compliance with the City Project construction documents and this Agreement. I Metropolitan Council No. 191014 3. The scope of the City Project is: Rehabilitate 1094 lineal feet of 12-inch concrete sanitary sewer with the installation of cured in-place pipe liner along with construction of temporary wastewater conveyance, erosion control, and restoration. 4. The locations of the City Project and the Council Project are shown on Exhibit A to this Agreement. II. Construction Documents l. The Council, will prepare the necessary detailed construction documents for the City Project ("City Project Construction Documents"). The City Project Construction Documents will contain plans and specifications and a schedule for construction of the City Project suitable for use by proposed contractors in the preparation of their bids. The Council will develop the City Project Construction Documents using the most current industry standards and practices. The Council or its agents have prepared a construction cost estimate for the City Project, attached as Exhibit B. 2. The Council will have a Registered Professional Engineer licensed in the State of Minnesota prepare certify the City Project Construction Documents that will be incorporated into the bidding documents for the Council Project. The Council will make all City Project Construction Documents available to the City. The City's Engineer or their representative must reject or approve all City Project Construction Documents before the City Project Construction Documents are incorporated into the plans for the Council Project. 3. The Council's Engineer will incorporate the City Project Construction Documents into the Council Project Construction Documents ("Combined Project Construction Documents") for the Council and City Projects ("Combined Project"). 4. The Council will provide the City with the Combined Project Construction Documents for comments prior to the solicitation for construction. The City will provide written comments of their review of the Combined Project Construction Documents to the Council within 14 days of receipt. Once the City and the Council have mutually agreed on the final draft of the Combined Project Construction Documents, the Council will begin the solicitation process. 5. The bid form will have a separate section for all construction bid items pertaining to the City Project. III. Easements and Permits 1. The City gives the Council the right to enter onto City property, and any easements and rights-of-way the City obtained for construction of the City Project for the purpose of the Council fulfilling this Agreement. 2 Metropolitan Council No. 191014 2. The Council will acquire all permanent and temporary permits, easements and property interests necessary in the Council's name for the Combined Project. The Council is not acquiring any property on the City's behalf. 3. As of the date of this Agreement, no additional property acquisition is required for construction and installation of the City Project. The City is responsible for any land acquisitions outside of the Council Project boundaries. 4. The Council is responsible for getting all other permits associated with construction of the Combined Project. IV. Procedure for Acceptance of Bids 1. Bidding Procedure. The Council will advertise for bids for the work and construction of the Combined Project, receive and open bids and may, subject to City's acceptance of the bid submitted, enter into a construction contract with the successful bidder in accordance with applicable law. The bidding documents will require separate line items, percentages, or agreed quantities within a line item for the City Project bid items. After opening the bids, the Council will give the City a written tabulation of the bids with the Council's recommendation for selection of the lowest responsible bidder. 2. City May Accept or Reject of City Project Bid Amount. a. City Project Bid Amount is equal to or less than the estimate. If the line items for the City Project in the bid total is less than or equal to the construction cost estimate in the final City Project Construction Documents in Exhibit B (excluding contract administration costs), the City accepts the bid for the City Project and the Council will award the City Project portion of the bid. b. City Project Bid is more than estimate. If the line items for the City Project in the bid are more than the construction cost estimate in the final City Project Construction Documents in Exhibit B (excluding contract administration costs), the Council will award the City Project portion of the bid only if the City gives the Council written notice stating the City agrees to be bound by the bid prices for the City Project. If the Council does not receive written notification of the City's acceptance of the bid prices within 14 days ofreceiving the bid tabulation, the Council will reject the City Project portion of the bid. c. Compensation to the Council ifthe City Does Not Proceed with its Project. If the City does not accept the bid amount for the City Project as described in section IV.2.b above, or otherwise decides before the Council's 3 Metropolitan Council No. 191014 award of the Combined Project not to proceed with the City Project, the City will reimburse the Council for City Project-related costs incurred by the Council as of the date of termination. A decision by the City not to construct the City Project has no bearing on the Council's ability to proceed with the Council Project. 3 . Council decision not to award Council Project. If the Council decides not to award the Council Project, this contract terminates without further liability between the Parties. v. Construction and Contract Administration 1. The Council will include in the construction contract for the Combined Project, the City Project Construction Documents, and require that the contractor construct the City Project according to these Documents . At least 14 days before the contractor begins work on the City Project, the Council will give written notice to the City that the contractor will begin construction by sending notice to: Contact: Title: Address: Email: Jason Wedel Public Works Director/City Engineer 7700 Market Boulevard P .O . Box 147 Chanhassen, MN 55317 JW e del@ ci .c hanhassen .mn . u s 2. The Council will perform and direct all construction superv1s1on, contract administration and inspections required to complete the Combined Project. The Council will not interrupt the City's sewer or water service during the construction of the City Project without the written consent of the City. 3. The City's authorized representative, Steve Ferraro, may observe the work during the construction of the City Project, but the City's authorized representative is not responsible for supervising the City Project. When observing the work, the City's authorized representative will cooperate with the Council's Engineer or designated representative. The City's authorized representative will be available to the Council at all times during construction of the City Project. The City will designate an authorized representative with the authority and experience to make decisions concerning the construction of the City Project so as not to delay construction of the Council Project or the Combined Project. 4. If after installation, the City determines that any portion of the City Project was not constructed substantially in accordance with the City Project Construction Documents, the City's authorized representative will inform the Council of the deficiency within thirty days. The City's notice to the Council will also explain why the portion of the City Project does not conform to the City Project Construction Documents and the actions the City believes the 4 Metropolitan Council No. 191014 contractor will take to correct the deficiency. The Council will require the contractor to make the corrections to meet the requirements of the City Project Construction Documents. 5. The City's authorized representative will participate in the inspection of the City Project for substantial completion. Within seven days of any substantial completion inspection, the City will provide the Council the punch list items that need to be addressed before final completion of the City Project. If the City does not provide punch list items within seven days, the contractor's work will be deemed accepted. 6. The Council will inform the City in writing of final completion of construction (including the punch list items) of the City Project. Within seven days of receiving the Council's written notice, the City will inform the Council in writing whether the City Project conforms to the City Project Construction Documents. The City makes the final decision on whether the contractor's City Project work conforms to the City Construction Documents. In order to accept the work on the City Project, the City will provide the Council a letter from the City's Public Works Director. 7. The City will participate in the claims process on the Combined Project for the following types of contractor claims: a. Project delays relating in any way to site conditions; and b. City requests for changes or modifications to any construction documents (City Project, Council Project, or Combined Project). c. Project delays caused by untimely response to the inspection requirements in Section 3- and 6 of Article V. The City will pay the portion of any claim that relates to the acts of the City. VI. Modifications to Construction Documents 1. The Council with City approval may make minor changes in the City Project Construction Documents and the Combined Project Construction Documents ifthe changes are necessary to complete construction. The Council may also enter into any change orders or supplemental agreements with the contractor on the Combined Project to incorporate these changes iri the City Project or Combined Project Constriiction documents. These dianges may result in a change to the City's cost participation described in Section VII. 2. The Council will give the City's Authorized Representative all proposed amendments and material changes to the City Project Construction Documents. The City will review the documents and communicate in writing its acceptance or rejection to the Council 5 Metropolitan Council No. 191014 within seven days. The Council will not amend. or change the City Project Construction Documents until it receives the City's written acceptance. 3. The City may make changes to the City Project if the all of the following occur: a. The City gives the Council seven days written notice; b. The City bears the costs of all changes; and c. The change does not increase the cost or delay completion of the Council Project. VII. Cost Participation and Payment 1. The City will reimburse the Council for the costs shown in Exhibit B as specified in this Section VII. The City will reimburse the Council for the actual cost of construction for the City Project, actual costs of construction for portions of the Combined Project as identified in Exhibit B, actual land acquisition costs as shown below, plus seven percent of the City Project construction cost. The additional seven percent is for the following: a. surveying, inspection, and testing for the City Project; and b. other costs associated with the City or Combined Project including land acquisition and contract administration, and other administrative expenses associated with the City or Combined.Project. 2. The Council, at its sole expense will acquire in its name all permanent and temporary permits, easements, and property interests necessary for the Combined Project. 3. The parties further agree that the City Project costs are an estimate. The final City Project construction costs will be based on the unit prices in the Council's construction contract, the final quantities, and any amendments or change orders. 4. After the Council awards the Combined Project Construction Contract, the Council will prepare a revised Exhibit Band give it to the City. The revised Exhibit B will update the City Project costs for construction, land acquisition, and administration based 7% of the City Project portion of the construction cost. The parties will substitute the revised Exhibit B for the Exhibit B attached to this Agreement without any amendment to this Agreement. 5. The Council will pay its contractor for the contractor's work on the City Project. The City will then pay the Council under this section. During construction, the Council will submit monthly invoices to the City. The Council's monthly invoices will include a progress report. The City will pay the Council within 30 days after it receives the invoice. If the City disputes any portion of an invoice it will give the Council notice of the dispute within 14 days after the City 6 Metropolitan Council No. 19IO 14 receives the invoice. If the City disputes any portion of an invoice, the City will pay the undisputed portion of the invoice within 30 days after receives the invoice, and it will pay the remainder of any amount due within 30 days after the dispute is resolved. 6. When the work on the Combined Project is substantially complete, the Council will give the City an updated cost participation breakdown. This cost participation breakdown will show actual construction costs based on the contract unit prices and the units of work the contractor performed. The updated cost participation breakdown will also contain the updated administrative and other costs to be paid to the Council by City. 7. If after subtracting the City's payments from the updated cost participation breakdown the City owes the Council money, the Council will invoice the City for that amount. The City will then pay the Council the amount owed within 30 days of receiving the invoice. If the City has already paid more than the updated cost participation breakdown, the Council will refund the City's excess amount without interest. VIII. Warranties/Maintenance I. The City Project bonds and warranties will be issued in the name of the Council. Once construction of the City Project is complete and the City accepts the City Project, the City Project will be under the full control of the City and all bonds, warranties and guarantees provided by the sureties, construction contractors and subcontractors for the City Project are the property of City. If a surety prohibits assignment, then the Council will require the contractor to ensure that the affected bond or warranty applies both to the Council and the City. 2. After acceptance of the City Project by the City the City is responsible for operation and maintenance of the City Project. IX. Liability 1. To the extent authorized by law each party is responsible only for its own acts and the results of its acts. The City's and Council's liability is governed by the provisions of Minnesota Statutes, Chapter 466. To the full extent permitted by law, actions by the parties pursuant to this Agreement are intended to be and shall be construed as a "cooperative activity" and it is the intent of the parties that they shall be deemed a "single governmental unit" for the purposes of liability, all as set forth in Minn. Stat.§ 47L59, Subd. la (a); provided furtherthat for purposes of that statute, each party to this Agreement expressly declines responsibility for the acts or omissions of the other party. 2. The City and Council each warrant that they have an insurance or self-insurance program with minimum coverage consistent with the liability limits in Minnesota Statutes, Chapter 466. Nothing in this Agreement is a waiver or limitation of any immunity or limitation 7 Metropolitan Council No. 191014 . of liability by the City or Council. 3. The Council will ensure that the Combined Project construction contract includes clauses that: a. require the Combined Project contractor to defend, indemnify, and hold harmless the City, its officers, agents and employees from claims, suits, demands, damages, judgments, costs, interest, expenses (including reasonable attorney's fees, witness fees and disbursements) arising out of or by reason of the negligent acts or omissions of the Contractor, its officers, employees, agents or subcontractors; b. require the Combined Project contractor to provide and maintain insurance and name the City as additional insured; and c. require the Combined Project contractor to be an independent contractor for the purposes of completing the work on the City Project. x. General Provisions 1. All records kept by the City and Council with respect to the Council Project are subject to examination by representatives of each party. All data collected, created, received, maintained or disseminated for any purpose by the City and Council under this Agreement are governed by Minnesota Statutes, Chapter 13("Act"), and the Minnesota Rules implementing the Act. 2. The City agrees to comply with all laws applicable to the City relating to nondiscrimination, affirmative action, public purchases, contracting, employment, workers' compensation, and surety deposits required for construction contracts. Minnesota Statutes, Section 181.59 and any applicable local ordinance relating to civil rights and discrimination and the Affirmative Action Policy statement of the City is considered a part of this Agreement. 3. The employees of the parties, and all other persons engaged by each party will not be considered employees of the other party. Each party is solely responsible for all claims arising from its employees including claims under the Worker's Compensation Act, the Minnesota Economic Security Law and all third party claim resulting from an act or omission of an employee. 4. If hazardous wastes, pollutants or contaminants as those terms are defined in law exist on the Combined Project site, the City is responsible for any response or remedial action, monitoring or reporting under the law. The City will apply for and have the Council named as a beneficiary in any no association letters, no action/no further action letters and other environmental regulatory assurances for the site. The City will give the Council copies of any Phase I and Phase II environmental investigations, approved Response Action Plans, and environmental assurance letters naming the Council as a beneficiary. Nothing in this paragraph 8 Metropolitan Council No. 191014 requires that the City accept responsibility for any environmental conditions that are not the City's legal responsibility. This paragraph survives the termination of this Agreement. S. The City's authorized representative will manage this Agreement for the City and act as a liaison between the City and Council. 6. The Council's Assistant General Manager of Technical Services in Environmental Services will manage this Agreement for the Council and act as a liaison between the Council and the City. 7. This Agreement is the entire agreement between the parties and supersedes all oral agreements and negotiations between the parties relating to this Agreement. All exhibits and attachments to this Agreement are incorporated into the Agreement. If there is a conflict between the terms of this Agreement and any of the exhibits the Agreement governs. 8. The provisions of this Agreement are severable. If a court finds any part of this Agreement void, invalid, or unenforceable, it will not affect the validity and enforceability of the remainder of this Agreement. A waiver by a party of any part of this Agreement is not a waiver of any other part of the Agreement or of a future breach of the Agreement. 9. Any modifications to this Agreement will be in writing as a formal amendment. 10. This Agreement is binding upon and for the benefit of the parties and their successors and assigns. This Agreement is not intended to benefit any third-party. 11. Except as otherwise provided for in this Agreement, the Agreement may be terminated by the mutual agreement of the parties. 12. If a force majeure event occurs, neither party is responsible for a failure to perform or a delay in performance due to the force majeure event. A force majeure event is an event beyond a party's reasonable control, such as unusually severe weather, fire, floods, other acts of God, labor disputes, acts of war or terrorism, or public health emergencies. 13. Under Minnesota Statutes, Section 16C.OS, subdivision S, the Parties agree that the books, records, documents, and accounting procedures and practices relevant to this Agreement are subject to examination by either Party and the state auditor or legislative auditor, as appropriate, for at least six years from the end of this Agreement. 14. A party will sent send a!Hil.l>tiefes or.:oematids under this:4greerilent either by: a. certified mail; b. e-mail, as long as the recipient acknowledges receipt by e-mail or otherwise in writing; or 9 Metropolitan Council N o . 191014 c. delivered in person to the other party addressed to the fo ll owing authorized representatives: Assistant Genera l Manager, Technical Services Metropolitan Council Environmental Services 390 Robert Street Nmth St. Paul, MN 55101-1805 Public Works Director/City Engineer City of Chanhassen 7700 Market Boulevard P.O. Box 147 Chanhassen, MN 55317 15. The parties will use a dispute resolution process for any unresolved dispute between the parties before exercising any legal remedies. The dispute resolution process is a three level dispute resolution ladder that escalates a dispute from the project management level thro ugh the executive m anagement level. At each level of the dispute resolution process, the Parties' representatives will meet and exp lore resolution until either party determines that effective resolution i s not possible at the current level, and notifies the other party that the process is elevated to the next level. The patties designate the following dispute resolution representatives: City Representative Council Representative Level 1 Project Engineer Manager, Interceptor Project Delivery Level 2 City Engineer Assistant Genera l Manager Level 3 City Manager General Manager, Environmental Services The parties will complete the dispute resolution process in good faith before reso1ting to any other legal process or remedy. 16. Council and the City are each authori zed to enter into this Agree ment pursuant to Council Action No. N/A approved on s:/2-'i>,/t 40'.\ [The remainder of this page is intentionally blank .] 10 Metropolitan Council No. 191014 METROPOLITAN COUNCIL, A public corporation and political subdivision of the State of Minnesota By:~~ Date: 7 -~ ~-IC[ CITY OF CHANHASSEN A municipal corporation of the State of Minnesota By: ;£.~pJJ+ t .. ~iv- Date: (;-3-1 ~ and ----+.,~~-K'-\,-~-IZ"-'4"-A~'-"--"-'""'-< ~-1-m..L...· <-.<.11.......,v<.+l.L..;;IL..=--- Name, Title7 / ' / Date: 5/11/JC/ ~ , RECOMMENDED FOR APPROVAL: By: ~ l>W.hC.1&1¥<!\ b~ U'Natne:fille Date: C../5 {I 'I 11 Metropolitan Council No. 191014 LIST OF EXHIBITS Exhibit A -City Project and Council Project Locations Exhibit B -Council Project Construction Costs Estimates 12 Bid Item 1 2 3 4 5 6 7 8 EXHIBITB CHANHASSEN INTERCEPTOR REHAB 8253·328 OPINION OF PROBABLE COST-CITY OF CHANHASSEN PORTION 04/12/2019 • HR Green Item Units QuantiiV Unit Price Erosion Control -City LF 2200 $ 4 Final CCTV Televislng -City LF 1100 $ 5 Sanitary Pipe Cleanlng & Disposal -City LF 1100 $ 3 12• CIPP Lining -City LF 1100 $ 50 Wetland Work & Restoration LS 1 $ 10,000 Chemical Grouting -City GAL 25 $ 60 Temporary Conveyance LS 1 $ 15,000 Restoration of Privately Owned Improvements LS 1 $ 5,000 Subtotal Engineering & Administration 7% Total Extended Amount $8,800 $5,500 $3,300 $55,000 $10,000 $1,500 $15,000 $5,000 $105,000 $7,350 $112,350 THE COUNCIL PROJECTMICHAEL J GORRAPRINCE R NELSONPRINCE R NELSONPRINCE R NELSONPRINCE R NELSONJ & C TIETZTRUSTSPAISLEY PARKENTERPRISEST & ETREATCHANHASSEN CITYMICHAEL J GORRAMH43MH44MH45MH46MH48MH47MH49MH50MH51MH52MH53MH54MH54AMH42MH16060MH16059MH21080MH21077MH21078MH21079MH21069MH16063MAJESTIC WAYWINDMILL DR CO R D N O . 1 1 7 ( G A L P I N B O U L E V A R D )THE COUNCIL PROJECTTHE CITYPROJECTTHE CITYPROJECTPRELIMINARY NOT FORCONSTRUCTION01" = 200' (HORIZONTAL)200' 400'GENERAL NOTES:1. THE COUNCIL PROJECTSTARTS AT MH54 & RUNS WITHMCES INTERCEPTOR 8253-328TO MH44.2. THE CITY PROJECT STARTSLINING AT MH21078 & RUNS TOITS JUNCTION WITH MCESINTERCEPTOR 8253-328.3. THE COUNCIL PROJECT & THECITY PROJECT CONNECT ATMCES MH46.FIG-1CHANHASSEN INTERCEPTOR REHABILITATION 8253-328PROJECT SCOPE802883ADAM R. SALOXX/XX/1945107ARSJJCXX/XX/19KJAISSUED FOR BIDDING3/8/2019 8:51:24 AM 802883-SCOPE3/8/2019 8:51:45 AM ARSJ:\2018\20180012.04\CAD\PRELIM\802883-SCOPE.DWG ---- TSREVISIONSDATEN0BYREMARKSDATEN0REVISIONSBYREMARKSCHECKEDDRAWNDESIGNEDPROFESSIONAL UNDER THE LAWS OF THE STATE OF MINNESOTA.BY ME OR UNDER MY DIRECT SUPERVISION AND THAT I AM A DULY LICENSEDI HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORT WAS PREPAREDDATEREG NOMODIFIED:TYPED OR PRINTED NAME:SIGNATURE:FILE NAMEPROJECTPLOTTED:OFEXHIBIT A Metrolpolitan Council No. 19I014 Bid Item Unit Qnty Unit Cost Total 1 Erosion Control ‐ City LF 2200 $22 $48,400 2 Final CCTV Televising ‐ City LF 1100 $1 $1,100 3 Sanitary Pipe Cleaning & Disposal ‐ City LF 1100 $1 $1,100 4 12" CIPP Lining ‐ City LF 1100 $56 $61,600 5 Wetland Work & Restoration LS 1 $94,500 $94,500 6 Chemical Grouting ‐ City GAL 25 $100 $2,500 7 Manhole Rehabilitation ‐ City EA 3 $4,600 $13,800 8 Temporary Conveyance LS 1 $12,500 $12,500 9 Restoration of Privately Owned Improvements LS 1 $5,000 $5,000 $240,500 $16,835 $257,335 Engineering & Administration 7% Total EXHIBIT B (REVISED) CHANHASSEN INTERCEPTOR REHAB 8253‐328 BID RESULTS ‐ CITY OF CHANHASSEN PORTION NOVEMBER 6, 2019 Subtotal CITY OF CHANHASSEN CARVER AND HENNEPIN COUNTIES, MINNESOTA DATE: November 12, 2019 RESOLUTION NO: 2019-XX MOTION BY: SECONDED BY: A RESOLUTION AUTHORIZING THE METROPOLITAN COUNCIL ENVIRONMENTAL SERVICES TO AWARD A CONTRACT FOR CONSTRUCTION OF THE CITY PORTION OF WORK FOR PROJECT NO. 19-02 WHEREAS, pursuant to the construction cooperation agreement entered into with the Minnesota Council Environmental Services (“MCES”) for CIPP sanitary sewer lining for the city portion of work for Sanitary Sewer (I/I) Project No. 19-02, MCES proposes to award a contract to Visu-Sewer, the lowest responsible bid for base bid, and a total bid amount of $240,500.00 for the city portion of work. NOW THEREFORE, BE IT RESOLVED by the Chanhassen City Council that the city authorizes MCES to award a contract to Visu-Sewer for the city portion of work for the Sanitary Sewer (I/I) Project No. 19-02, according to the plans and specifications, and agrees to be bound by the bid prices under the contract. Passed and adopted by the Chanhassen City Council this 12th day of November, 2019. ATTEST: Todd Gerhardt, City Manager Elise Ryan, Mayor YES NO ABSENT CITY COUNCIL STAFF REPORT Tuesday, November 12, 2019 Subject Review of Claims Paid 11122019 Section CORRESPONDENCE DISCUSSION Item No: K.1. Prepared By Greg Sticha, Finance Director File No: SUMMARY The following claims are submitted for review on November 12, 2019: Check Numbers Amounts 171939 – 172010 $355,926.93 ACH Payments $501,525.52 Total All Claims $857,452.45 ATTACHMENTS: Check Summary Check Summary ACH Check Detail Check Detail ACH Accounts Payable User: Printed: dwashburn 11/1/2019 12:09 PM Checks by Date - Summary by Check Number Check No Check DateVendor NameVendor No Void Checks Check Amount AmeTes AMERICAN TEST CENTER 10/24/2019 0.00 150.00171939 AndeJoan Joan Anderson 10/24/2019 0.00 75.00171940 AspMil ASPEN MILLS 10/24/2019 0.00 640.15171941 BCATRA BCA 10/24/2019 0.00 15.00171942 BialErMe Eric & Melinda Bialke 10/24/2019 0.00 7.65171943 BlazMary Mary Blazanin 10/24/2019 0.00 195.58171944 BonPlu BONFES PLUMBING & HEATING 10/24/2019 0.00 42.75171945 BorSta BORDER STATES ELECTRIC SUPPLY 10/24/2019 0.00 447.30171946 CenLin CenturyLink 10/24/2019 0.00 59.63171947 ColeRoLo Ronald & Lori Coleman 10/24/2019 0.00 108.66171948 CorMai CORE & MAIN LP 10/24/2019 0.00 116.86171949 CROCOL CROWN COLLEGE 10/24/2019 0.00 725.00171950 CubFoo CUB FOODS 10/24/2019 0.00 31.96171951 dcbra DC Braun Company Inc 10/24/2019 0.00 1,095.00171952 DonSod DON'S SOD SERVICE 10/24/2019 0.00 2,238.50171953 EstLau Estate of Lauria H Reiff 10/24/2019 0.00 36.34171954 FerEnt Ferguson Enterprises, Inc. #1657 10/24/2019 0.00 193.50171955 FirSaf Fire Safety USA 10/24/2019 0.00 832.10171956 GonHom GONYEA HOMES 10/24/2019 0.00 4,000.00171957 HeinRobe ROBERT HEINEN 10/24/2019 0.00 95.93171958 HOOPTHRE Hoops & Threads LLC 10/24/2019 0.00 36.00171959 husbdani Daniel Husby 10/24/2019 0.00 43.07171960 ICMART ICMA RETIREMENT AND TRUST-457 10/24/2019 0.00 1,366.67171961 JerTra JERRY'S TRANSMISSION SER.10/24/2019 0.00 122.22171962 JMSCUST JMS Custom Homes LLC 10/24/2019 0.00 750.00171963 JohnDon Don Johnson 10/24/2019 0.00 12.87171964 KnoBui KNOBLAUCH BUILDERS LLC 10/24/2019 0.00 750.00171965 LEAINS LEAGUE OF MN CITIES INS TRUST 10/24/2019 0.00 3,224.80171966 MausKerr Kerry Maus 10/24/2019 0.00 312.75171967 McMCar MCMASTER-CARR SUPPLY CO 10/24/2019 0.00 163.63171968 MinAir MINNESOTA AIR 10/24/2019 0.00 7.14171969 MNCOMM MINNESOTA DEPARTMENT OF COMMERCE10/24/2019 0.00 186.55171970 MINROA Minnesota Roadways Co 10/24/2019 0.00 218.45171971 MinuPre Minuteman Press 10/24/2019 0.00 16.00171972 NielKevi Kevin Nielsen 10/24/2019 0.00 542.37171973 CapAge Scott-Carver-Dakota CAP Agency Inc 10/24/2019 0.00 2,100.00171974 TayEle Taylor Electric Company, LLC 10/24/2019 0.00 1,639.00171975 OSSCON The Osseo Construction Company LLC 10/24/2019 0.00 285,773.68171976 Therme Thermech 10/24/2019 0.00 2,220.00171977 ValRic VALLEY-RICH CO INC 10/24/2019 0.00 8,893.51171978 WastMana Waste Management of Minnesota, Inc 10/24/2019 0.00 216.45171979 WingRich RICHARD WING 10/24/2019 0.00 100.00171980 AmeLeg AMERICAN LEGION-CHAN POST 580 10/31/2019 0.00 161.74171981 ArenMath Matthew & Amanda Arens 10/31/2019 0.00 2,500.00171982 ChaOPC Champion OPCO LLC 10/31/2019 0.00 15.15171983 ComTra COMMISSIONER OF TRANSPORTATION10/31/2019 0.00 75.32171984 CorMai CORE & MAIN LP 10/31/2019 0.00 390.00171985 Page 1AP Checks by Date - Summary by Check Number (11/1/2019 12:09 PM) Check No Check DateVendor NameVendor No Void Checks Check Amount CULLIG CULLIGAN 10/31/2019 0.00 5.13171986 DyvCon Dyvig Construction LLC 10/31/2019 0.00 500.00171987 GerhTodd TODD GERHARDT 10/31/2019 0.00 83.00171988 GonHom GONYEA HOMES 10/31/2019 0.00 5,100.00171989 HammJoRu Jon & Ruth Hammarberg 10/31/2019 0.00 250.00171990 JLTHEI JL Theis Inc 10/31/2019 0.00 2,000.00171991 JMSCUST JMS Custom Homes LLC 10/31/2019 0.00 5,000.00171992 JOHMAR MaryAnn Johnson 10/31/2019 0.00 86.00171993 josroy Joseph Roy Construction 10/31/2019 0.00 250.00171994 K2Ele K2 Electrical Services Inc 10/31/2019 0.00 173.20171995 KenGra KENNEDY & GRAVEN, CHARTERED 10/31/2019 0.00 5,487.90171996 KletLaur Lauren Campbell Klett 10/31/2019 0.00 250.00171997 KnoBui KNOBLAUCH BUILDERS LLC 10/31/2019 0.00 5,600.00171998 KoehThEr Thomas & Erica Koehnen 10/31/2019 0.00 500.00171999 McKMed McKesson Medical-Surgical Inc 10/31/2019 0.00 106.35172000 NusTru Nuss Truck Group Inc 10/31/2019 0.00 172.36172001 PELRICK RICHARD PELZEL 10/31/2019 0.00 1,000.00172002 Post POSTMASTER 10/31/2019 0.00 1,225.07172003 PULTGROU Pulte Group Pulte Homes of MN LLC 10/31/2019 0.00 2,500.00172004 ScriJoTi John & Tina Scribante 10/31/2019 0.00 250.00172005 SouLoc SOUTHWEST LOCK & KEY 10/31/2019 0.00 712.00172006 SwaHom SWANSON HOMES 10/31/2019 0.00 750.00172007 TFOFIN TFORCE FINAL MILE 10/31/2019 0.00 76.76172008 VictPaBe Pat & Beth Victorian 10/31/2019 0.00 500.00172009 WastMana Waste Management of Minnesota, Inc 10/31/2019 0.00 404.88172010 Report Total (72 checks): 355,926.93 0.00 Page 2AP Checks by Date - Summary by Check Number (11/1/2019 12:09 PM) Accounts Payable Checks by Date - Summary by Check User: dwashburn Printed: 11/1/2019 12:10 PM Check Vendor No Vendor Name Check Date Void Checks Check Amount ACH AdaPes ADAM'S PEST CONTROL INC 10/24/2019 0.00 131.25 ACH Avesis Fidelity Security Life 10/24/2019 0.00 202.75 ACH BensKaye KAYE L BENSON 10/24/2019 0.00 560.00 ACH CarGra CarteGraph Systems 10/24/2019 0.00 35,125.00 ACH DaniReem Reem Danial 10/24/2019 0.00 313.60 ACH DelDen Delta Dental 10/24/2019 0.00 2,550.10 ACH ElePum ELECTRIC PUMP INC 10/24/2019 0.00 1,619.91 ACH FasCom FASTENAL COMPANY 10/24/2019 0.00 22.85 ACH FergEnte Ferguson Waterworks #2516 10/24/2019 0.00 1,007.71 ACH GeaWas Gear Wash, LLC 10/24/2019 0.00 2,569.68 ACH GilMec GILBERT MECHANICAL CONTRACTORS 10/24/2019 0.00 902.90 ACH GMHAsp GMH ASPHALT CORP 10/24/2019 0.00 309,317.90 ACH HoiKoe HOISINGTON KOEGLER GROUP 10/24/2019 0.00 8,043.34 ACH KatFue KATH FUEL OIL SERVICE 10/24/2019 0.00 707.00 ACH MVEC MN VALLEY ELECTRIC COOP 10/24/2019 0.00 107.61 ACH Napa NAPA AUTO & TRUCK PARTS 10/24/2019 0.00 84.54 ACH OpeShu OPEN AND SHUT ENTERPRISES INC 10/24/2019 0.00 1,572.00 ACH PreWat Premium Waters, Inc 10/24/2019 0.00 12.30 ACH RBMSer RBM SERVICES INC 10/24/2019 0.00 7,054.47 ACH SubChe SUBURBAN CHEVROLET 10/24/2019 0.00 40.50 ACH sunLif Sun Life Financial 10/24/2019 0.00 1,446.95 ACH UNIWAY UNITED WAY 10/24/2019 0.00 29.40 ACH Waytek WAYTEK INC 10/24/2019 0.00 108.95 ACH WmMue WM MUELLER & SONS INC 10/24/2019 0.00 2,758.61 ACH WWGra WW GRAINGER INC 10/24/2019 0.00 42.30 ACH Xcel XCEL ENERGY INC 10/24/2019 0.00 14,284.16 ACH AFLAC American Family Life Assurance Company of Columbus 10/31/2019 0.00 39.78 ACH AlhiJuli Juli Al-Hilwani 10/31/2019 0.00 146.25 ACH BoyTru Boyer Ford Trucks 10/31/2019 0.00 66.50 ACH ColLif Colonial Life & Accident Insurance Co 10/31/2019 0.00 134.58 ACH CryInf Crystal Infosystems LLC 10/31/2019 0.00 704.87 ACH HydKle Hydro-Klean LLC 10/31/2019 0.00 16,491.01 ACH InnOff Innovative Office Solutions LLC 10/31/2019 0.00 279.58 ACH JefFir JEFFERSON FIRE SAFETY INC 10/31/2019 0.00 590.37 ACH KimHor KIMLEY HORN AND ASSOCIATES INC 10/31/2019 0.00 3,511.25 ACH MesKra MESSERLI & KRAMER P.A. 10/31/2019 0.00 6,600.00 ACH MVEC MN VALLEY ELECTRIC COOP 10/31/2019 0.00 159.44 ACH NysPub NYSTROM PUBLISHING COMPANY INC 10/31/2019 0.00 8,174.04 ACH PedrChri Christine Lea Pedretti 10/31/2019 0.00 720.20 ACH PomTir POMP'S TIRE SERVICE INC 10/31/2019 0.00 3,249.48 ACH SafFas Safe-Fast, Inc. 10/31/2019 0.00 65.90 ACH SNATOO SNAP-ON INDUSTRIAL 10/31/2019 0.00 155.27 Page 1 of 2 Check Vendor No Vendor Name Check Date Void Checks Check Amount ACH UltCon ULTIMATE CONTROLS ELECTRIC LLC 10/31/2019 0.00 1,132.50 ACH Wmmue WM MUELLER & SONS INC 10/31/2019 0.00 1,025.10 ACH wSB WSB & ASSOCIATES INC 10/31/2019 0.00 45,152.00 ACH Xcel XCEL ENERGY INC 10/31/2019 0.00 22,511.62 Report Total: 0.00 501,525.52 Page 2 of 2 Accounts Payable Check Detail-Checks User: dwashburn Printed: 11/01/2019 - 12:17 PM Name Check Da Account Description Amount AMERICAN LEGION-CHAN POST 580 10/31/2019 202-0000-4300 Appetizers-Cemetery walk cast and crew 161.74 AMERICAN LEGION-CHAN POST 580 161.74 AMERICAN TEST CENTER 10/24/2019 101-1370-4530 Annual safety inspection-Auto Lift #1 & #2 150.00 AMERICAN TEST CENTER 150.00 Anderson Joan 10/24/2019 101-1539-4300 Pickleball lesson-10/21/19 75.00 Anderson Joan 75.00 Arens Matthew & Amanda 10/31/2019 815-8226-2024 As Built escrow-7644 South Shore Drive 2,500.00 Arens Matthew & Amanda 2,500.00 ASPEN MILLS 10/24/2019 101-1220-4240 collar brass silver bugles 46.55 ASPEN MILLS 10/24/2019 101-1220-4240 class A coat/trouser/cap 593.60 ASPEN MILLS 640.15 BCA 10/24/2019 101-1120-4300 Background Investigation 15.00 BCA 15.00 Bialke Eric & Melinda 10/24/2019 700-0000-2036 Utility account refund-8652 Valley Ridge Ct 2.64 Bialke Eric & Melinda 10/24/2019 701-0000-2036 Utility account refund-8652 Valley Ridge Ct 4.15 Bialke Eric & Melinda 10/24/2019 720-0000-2036 Utility account refund-8652 Valley Ridge Ct 0.86 Bialke Eric & Melinda 7.65 Blazanin Mary 10/24/2019 101-1560-4120 Tip for Boone Railroad trip 160.00 Blazanin Mary 10/24/2019 101-1560-4120 napkins/placemats/Glenn Campbell DVD 35.58 Blazanin Mary 195.58 BONFES PLUMBING & HEATING 10/24/2019 101-0000-2033 Permit overpayment-7610 Iroquois 20.25 BONFES PLUMBING & HEATING 10/24/2019 101-0000-2033 Permit overpayment-7679 Bluebonnet Blvd 22.50 BONFES PLUMBING & HEATING 42.75 BORDER STATES ELECTRIC SUPPLY 10/24/2019 701-0000-4530 115V heater 447.30 BORDER STATES ELECTRIC SUPPLY 447.30 CenturyLink 10/24/2019 700-7043-4310 monthly charges 59.63 Accounts Payable - Check Detail-Checks (11/01/2019 - 12:17 PM)Page 1 of 6 Name Check Da Account Description Amount CenturyLink 59.63 Champion OPCO LLC 10/31/2019 101-0000-2033 refund permit overpayment-1702 West 63rd Street 15.15 Champion OPCO LLC 15.15 Coleman Ronald & Lori 10/24/2019 700-0000-2036 Utility account refund-6540 Devonshire Drive 36.78 Coleman Ronald & Lori 10/24/2019 701-0000-2036 Utility account refund-6540 Devonshire Drive 57.89 Coleman Ronald & Lori 10/24/2019 720-0000-2036 Utility account refund-6540 Devonshire Drive 13.99 Coleman Ronald & Lori 108.66 COMMISSIONER OF TRANSPORTATION10/31/2019 601-6039-4752 Traffic Signal Maintenance 75.32 COMMISSIONER OF TRANSPORTATION 75.32 CORE & MAIN LP 10/24/2019 701-0000-4551 4x2 IP saddle 116.86 CORE & MAIN LP 10/31/2019 701-0000-4553 6" insulated pipe 390.00 CORE & MAIN LP 506.86 CROWN COLLEGE 10/24/2019 101-1220-4370 EMT initial course-Marissa Smith 725.00 CROWN COLLEGE 725.00 CUB FOODS 10/24/2019 101-1220-4290 coffee/hot chocolate 31.96 CUB FOODS 31.96 CULLIGAN 10/31/2019 101-0000-2033 refund permit overpayment-1521 Heron Drive 5.13 CULLIGAN 5.13 DC Braun Company Inc 10/24/2019 701-0000-4530 LS 1-repair check valve 1,095.00 DC Braun Company Inc 1,095.00 DON'S SOD SERVICE 10/24/2019 101-1550-4300 topsoil/sod 2,238.50 DON'S SOD SERVICE 2,238.50 Dyvig Construction LLC 10/31/2019 815-8202-2024 Erosion escrow-6821 Redwing Lane 500.00 Dyvig Construction LLC 500.00 Estate of Lauria H Reiff 10/24/2019 700-0000-2036 Utility account refund-7141 Utica Lane 26.09 Estate of Lauria H Reiff 10/24/2019 701-0000-2036 Utility account refund-7141 Utica Lane 5.90 Estate of Lauria H Reiff 10/24/2019 720-0000-2036 Utility account refund-7141 Utica Lane 4.35 Estate of Lauria H Reiff 36.34 Ferguson Enterprises, Inc. #1657 10/24/2019 700-0000-4150 pipe/clamp/brass fitting/area wall fct 186.10 Ferguson Enterprises, Inc. #1657 10/24/2019 700-0000-4160 cttr whl 2 pk 7.40 Ferguson Enterprises, Inc. #1657 193.50 Accounts Payable - Check Detail-Checks (11/01/2019 - 12:17 PM)Page 2 of 6 Name Check Da Account Description Amount Fire Safety USA 10/24/2019 101-1220-4260 Hooligan Bar mounting kit 125.00 Fire Safety USA 10/24/2019 101-1220-4260 Quick fist clamp/nozzle clamp 101.10 Fire Safety USA 10/24/2019 101-1220-4260 threaded mounting plate/hydrant & spanner wrench 425.00 Fire Safety USA 10/24/2019 101-1220-4260 spanner wrenches w/ holder 181.00 Fire Safety USA 832.10 GERHARDT TODD 10/31/2019 101-1120-4370 baggage fee-ICMA conference 30.00 GERHARDT TODD 10/31/2019 101-1120-4360 Rotary membership 53.00 GERHARDT TODD 83.00 GONYEA HOMES 10/24/2019 815-8201-2024 Landscape Escrow-9277 Hawkcrest Ct 750.00 GONYEA HOMES 10/24/2019 815-8201-2024 Landscape Escrow-9317 Hawkcrest Ct 750.00 GONYEA HOMES 10/24/2019 815-8226-2024 As Built escrow-9160 Eagle Court 2,500.00 GONYEA HOMES 10/31/2019 815-8202-2024 Erosion escrow-9140 Eagle Court 2,600.00 GONYEA HOMES 10/31/2019 815-8226-2024 As Built escrow-7640 Windsor Court 2,500.00 GONYEA HOMES 9,100.00 Hammarberg Jon & Ruth 10/31/2019 815-8202-2024 Erosion escrow-177 Lakeview Rd E 250.00 Hammarberg Jon & Ruth 250.00 HEINEN ROBERT 10/24/2019 101-1550-4240 jeans/gloves 95.93 HEINEN ROBERT 95.93 Hoops & Threads LLC 10/24/2019 700-0000-4240 heavyweight hoodie 18.00 Hoops & Threads LLC 10/24/2019 701-0000-4240 heavyweight hoodie 18.00 Hoops & Threads LLC 36.00 Husby Daniel 10/24/2019 700-0000-2036 Utility account refund-7633 Century Blvd 15.88 Husby Daniel 10/24/2019 701-0000-2036 Utility account refund-7633 Century Blvd 24.94 Husby Daniel 10/24/2019 720-0000-2036 Utility account refund-7633 Century Blvd 2.25 Husby Daniel 43.07 ICMA RETIREMENT AND TRUST-457 10/24/2019 101-0000-2009 10/25/2019 ID #304303 1,060.42 ICMA RETIREMENT AND TRUST-457 10/24/2019 700-0000-2009 10/25/2019 ID #304303 152.50 ICMA RETIREMENT AND TRUST-457 10/24/2019 701-0000-2009 10/25/2019 ID #304303 152.50 ICMA RETIREMENT AND TRUST-457 10/24/2019 720-0000-2009 10/25/2019 ID #304303 1.25 ICMA RETIREMENT AND TRUST-457 1,366.67 JERRY'S TRANSMISSION SER.10/24/2019 101-1220-4140 handle assy 122.22 JERRY'S TRANSMISSION SER. 122.22 JL Theis Inc 10/31/2019 720-7202-4320 Wall repair-Kerber Blvd & Santa Vera Dr 2,000.00 JL Theis Inc 2,000.00 JMS Custom Homes LLC 10/24/2019 815-8201-2024 Landscape escrow-7510 Fawn Hill Road 750.00 JMS Custom Homes LLC 10/31/2019 815-8226-2024 As built escrow-2240 Bentz Court 2,500.00 JMS Custom Homes LLC 10/31/2019 815-8226-2024 As built escrow-2250 Bentz Court 2,500.00 Accounts Payable - Check Detail-Checks (11/01/2019 - 12:17 PM)Page 3 of 6 Name Check Da Account Description Amount JMS Custom Homes LLC 5,750.00 Johnson Don 10/24/2019 101-1220-4300 drop box business account 12.87 Johnson Don 12.87 Johnson MaryAnn 10/31/2019 101-1560-3637 refund-Hark!The Church Basement Ladies/Holiday party 86.00 Johnson MaryAnn 86.00 Joseph Roy Construction 10/31/2019 815-8202-2024 Erosion escrow-750 Preakness Lane 250.00 Joseph Roy Construction 250.00 K2 Electrical Services Inc 10/31/2019 101-1550-4300 change light bulb socket on light pole 173.20 K2 Electrical Services Inc 173.20 KENNEDY & GRAVEN, CHARTERED 10/31/2019 605-6501-4300 Acquisition of Right of Way for CR 101 4,752.00 KENNEDY & GRAVEN, CHARTERED 10/31/2019 601-0000-4300 Franchise Fees 735.90 KENNEDY & GRAVEN, CHARTERED 5,487.90 Klett Lauren Campbell 10/31/2019 815-8202-2024 Erosion escrow-8345 Stone Creek Drive 250.00 Klett Lauren Campbell 250.00 KNOBLAUCH BUILDERS LLC 10/24/2019 815-8201-2024 landscape escrow-320 Preserve Court 750.00 KNOBLAUCH BUILDERS LLC 10/31/2019 815-8202-2024 Erosion escrow-320 Preserve Court 1,800.00 KNOBLAUCH BUILDERS LLC 10/31/2019 815-8202-2024 Erosion escrow-340 Preserve Court 2,000.00 KNOBLAUCH BUILDERS LLC 10/31/2019 815-8202-2024 Erosion escrow-330 Preserve Court 1,800.00 KNOBLAUCH BUILDERS LLC 6,350.00 Koehnen Thomas & Erica 10/31/2019 815-8202-2024 Erosion escrow-6541 Devonshire Drive 500.00 Koehnen Thomas & Erica 500.00 LEAGUE OF MN CITIES INS TRUST 10/24/2019 101-1170-4483 ADA violations relating to City web page 3,224.80 LEAGUE OF MN CITIES INS TRUST 3,224.80 Maus Kerry 10/24/2019 101-1539-4300 Line Dancing instruction 312.75 Maus Kerry 312.75 McKesson Medical-Surgical Inc 10/31/2019 101-1220-4130 gloves 106.35 McKesson Medical-Surgical Inc 106.35 MCMASTER-CARR SUPPLY CO 10/24/2019 700-7043-4550 glass-tube fuses/concrete anchor/clamping 68.12 MCMASTER-CARR SUPPLY CO 10/24/2019 700-7043-4150 paper towel dispenser/threaded rods/rod mount 95.51 MCMASTER-CARR SUPPLY CO 163.63 MINNESOTA AIR 10/24/2019 101-1190-4510 copper fittings to vent regulars 7.14 Accounts Payable - Check Detail-Checks (11/01/2019 - 12:17 PM)Page 4 of 6 Name Check Da Account Description Amount MINNESOTA AIR 7.14 MINNESOTA DEPARTMENT OF COMMERCE10/24/2019 700-0000-2036 Unclaimed Property 53.36 MINNESOTA DEPARTMENT OF COMMERCE10/24/2019 701-0000-2036 Unclaimed Property 99.86 MINNESOTA DEPARTMENT OF COMMERCE10/24/2019 720-0000-2036 Unclaimed Property 33.33 MINNESOTA DEPARTMENT OF COMMERCE 186.55 Minnesota Roadways Co 10/24/2019 420-0000-4751 CSS-1H Asphalt Emulsion 218.45 Minnesota Roadways Co 218.45 Minuteman Press 10/24/2019 101-1170-4110 business cards-Loney 16.00 Minuteman Press 16.00 Nielsen Kevin 10/24/2019 605-6501-4807 Prorated property tax payment-740 Vogelsberg Trail 542.37 Nielsen Kevin 542.37 Nuss Truck Group Inc 10/31/2019 101-1320-4140 v-clamp/gasket/kit 172.36 Nuss Truck Group Inc 172.36 PELZEL RICHARD 10/31/2019 815-8202-2024 Erosion escrow-6681 Amberwood Ln 1,000.00 PELZEL RICHARD 1,000.00 POSTMASTER 10/31/2019 700-0000-4330 Utility bill postage 458.54 POSTMASTER 10/31/2019 701-0000-4330 Utility bill postage 458.54 POSTMASTER 10/31/2019 700-0000-4330 Utility bill postage 153.99 POSTMASTER 10/31/2019 701-0000-4330 Utility bill postage 154.00 POSTMASTER 1,225.07 Pulte Group Pulte Homes of MN LLC 10/31/2019 815-8202-2024 Erosion escrow-756 Stonegate Road 416.67 Pulte Group Pulte Homes of MN LLC 10/31/2019 815-8202-2024 Erosion escrow-754 Stonegate Road 416.67 Pulte Group Pulte Homes of MN LLC 10/31/2019 815-8202-2024 Erosion escrow-758 Stonegate Road 416.67 Pulte Group Pulte Homes of MN LLC 10/31/2019 815-8202-2024 Erosion escrow-764 Stonegate Road 416.66 Pulte Group Pulte Homes of MN LLC 10/31/2019 815-8202-2024 Erosion escrow-762 Stonegate Road 416.66 Pulte Group Pulte Homes of MN LLC 10/31/2019 815-8202-2024 Erosion escrow-760 Stonegate Road 416.67 Pulte Group Pulte Homes of MN LLC 2,500.00 Scott-Carver-Dakota CAP Agency Inc 10/24/2019 101-1430-4300 3rd quarter charges 2,100.00 Scott-Carver-Dakota CAP Agency Inc 2,100.00 Scribante John & Tina 10/31/2019 815-8202-2024 Erosion escrow-3100 Dartmouth Drive 250.00 Scribante John & Tina 250.00 SOUTHWEST LOCK & KEY 10/31/2019 701-0000-4510 Panic bar & door-Lift Station 24 712.00 SOUTHWEST LOCK & KEY 712.00 Accounts Payable - Check Detail-Checks (11/01/2019 - 12:17 PM)Page 5 of 6 Name Check Da Account Description Amount SWANSON HOMES 10/31/2019 815-8201-2024 Landscape escrow-7500 Chanhassen Road 750.00 SWANSON HOMES 750.00 Taylor Electric Company, LLC 10/24/2019 101-1350-4565 replace 2 runs of underground street lighting wire-W78th Street 1,639.00 Taylor Electric Company, LLC 1,639.00 TFORCE FINAL MILE 10/31/2019 101-1310-4300 delivery charges 76.76 TFORCE FINAL MILE 76.76 The Osseo Construction Company LLC 10/24/2019 700-7050-4751 Water Tower 3 rehabilitation 285,773.68 The Osseo Construction Company LLC 285,773.68 Thermech 10/24/2019 700-7019-4550 insulation patch and repair 2,220.00 Thermech 2,220.00 VALLEY-RICH CO INC 10/24/2019 700-0000-4550 County Road 101 & Sandy Hook -equipment/labor 8,893.51 VALLEY-RICH CO INC 8,893.51 Victorian Pat & Beth 10/31/2019 815-8202-2024 Erosion escrow-8530 Merganser Court 500.00 Victorian Pat & Beth 500.00 Waste Management of Minnesota, Inc 10/24/2019 101-1220-4375 20 yard open top--open house 216.45 Waste Management of Minnesota, Inc 10/31/2019 101-1550-4300 20 yd rolloff-Lake Ann park 404.88 Waste Management of Minnesota, Inc 621.33 WING RICHARD 10/24/2019 101-1220-4350 Station 2 cleaning-September 100.00 WING RICHARD 100.00 355,926.93 Accounts Payable - Check Detail-Checks (11/01/2019 - 12:17 PM)Page 6 of 6 Accounts Payable Check Detail-ACH User: dwashburn Printed: 11/01/2019 - 12:17 PM Name Check Da Account Description Amount ADAM'S PEST CONTROL INC 10/24/2019 101-1170-4300 monthly service 131.25 ADAM'S PEST CONTROL INC 131.25 Al-Hilwani Juli 10/31/2019 101-1533-4300 personal training-Sandy Christensen 146.25 Al-Hilwani Juli 146.25 American Family Life Assurance Company of Columbus 10/31/2019 101-0000-2008 monthly charges 39.78 American Family Life Assurance Company of Columbus 39.78 BENSON KAYE L 10/24/2019 101-1539-4300 Fit for Life instruction 560.00 BENSON KAYE L 560.00 Boyer Ford Trucks 10/31/2019 101-1320-4140 nylon tubing 66.50 Boyer Ford Trucks 66.50 CarteGraph Systems 10/24/2019 400-4117-4703 Cartegraph OMS annual maintenance 8,531.25 CarteGraph Systems 10/24/2019 700-7025-4703 Cartegraph OMS annual maintenance 8,531.25 CarteGraph Systems 10/24/2019 701-7025-4703 Cartegraph OMS annual maintenance 8,531.25 CarteGraph Systems 10/24/2019 720-7025-4703 Cartegraph OMS annual maintenance 8,531.25 CarteGraph Systems 10/24/2019 720-7025-4703 Cartegraph OMS annual maintenance 250.00 CarteGraph Systems 10/24/2019 701-7025-4703 Cartegraph OMS annual maintenance 250.00 CarteGraph Systems 10/24/2019 700-7025-4703 Cartegraph OMS annual maintenance 250.00 CarteGraph Systems 10/24/2019 400-4117-4703 Cartegraph OMS annual maintenance 250.00 CarteGraph Systems 35,125.00 Colonial Life & Accident Insurance Co 10/31/2019 101-0000-2008 monthly charges 60.72 Colonial Life & Accident Insurance Co 10/31/2019 700-0000-2008 monthly charges 36.93 Colonial Life & Accident Insurance Co 10/31/2019 701-0000-2008 monthly charges 36.93 Colonial Life & Accident Insurance Co 134.58 Crystal Infosystems LLC 10/31/2019 101-1170-4110 toner 458.92 Crystal Infosystems LLC 10/31/2019 101-1170-4110 toner 245.95 Crystal Infosystems LLC 704.87 Danial Reem 10/24/2019 101-1539-4300 Zumba instruction 313.60 Danial Reem 313.60 Delta Dental 10/24/2019 101-0000-2013 dental insurance-November 1,876.00 Accounts Payable - Check Detail-ACH (11/01/2019 - 12:17 PM)Page 1 of 6 Name Check Da Account Description Amount Delta Dental 10/24/2019 101-0000-2013 dental insurance-November 30.20 Delta Dental 10/24/2019 210-0000-2013 dental insurance-November 24.93 Delta Dental 10/24/2019 700-0000-2013 dental insurance-November 265.38 Delta Dental 10/24/2019 701-0000-2013 dental insurance-November 235.18 Delta Dental 10/24/2019 720-0000-2013 dental insurance-November 118.41 Delta Dental 2,550.10 ELECTRIC PUMP INC 10/24/2019 701-0000-4530 impeller 1,619.91 ELECTRIC PUMP INC 1,619.91 FASTENAL COMPANY 10/24/2019 101-1550-4120 1/4" x 2 1/2" PTO lk pin 22.85 FASTENAL COMPANY 22.85 Ferguson Waterworks #2516 10/24/2019 700-0000-4250 3/4 T10 meter/2 T10 meter 1,007.71 Ferguson Waterworks #2516 1,007.71 Fidelity Security Life 10/24/2019 101-0000-2007 Vision insurance-November 167.67 Fidelity Security Life 10/24/2019 210-0000-2007 Vision insurance-November 3.98 Fidelity Security Life 10/24/2019 700-0000-2007 Vision insurance-November 18.03 Fidelity Security Life 10/24/2019 701-0000-2007 Vision insurance-November 11.89 Fidelity Security Life 10/24/2019 720-0000-2007 Vision insurance-November 1.18 Fidelity Security Life 202.75 Gear Wash, LLC 10/24/2019 101-1220-4530 wash turnout gear 2,569.68 Gear Wash, LLC 2,569.68 GILBERT MECHANICAL CONTRACTORS 10/24/2019 700-0000-4530 Boiler repair 902.90 GILBERT MECHANICAL CONTRACTORS 902.90 GMH ASPHALT CORP 10/24/2019 601-6039-4751 Lake Drive East Street Imp Project 18-02 309,317.90 GMH ASPHALT CORP 309,317.90 HOISINGTON KOEGLER GROUP 10/24/2019 410-0000-4300 Chanhassen Lake Ann Trail-September 8,043.34 HOISINGTON KOEGLER GROUP 8,043.34 Hydro-Klean LLC 10/31/2019 701-7053-4751 2020 I&I project 16,491.01 Hydro-Klean LLC 16,491.01 Innovative Office Solutions LLC 10/31/2019 101-1170-4110 office supplies 279.58 Innovative Office Solutions LLC 279.58 JEFFERSON FIRE SAFETY INC 10/31/2019 400-4105-4705 gloves 590.37 JEFFERSON FIRE SAFETY INC 590.37 KATH FUEL OIL SERVICE 10/24/2019 101-1370-4170 oilmaster hd full syn atf 55 drum 707.00 Accounts Payable - Check Detail-ACH (11/01/2019 - 12:17 PM)Page 2 of 6 Name Check Da Account Description Amount KATH FUEL OIL SERVICE 707.00 KIMLEY HORN AND ASSOCIATES INC 10/31/2019 601-6043-4752 Minnewashta Parkway rehab 3,511.25 KIMLEY HORN AND ASSOCIATES INC 3,511.25 MESSERLI & KRAMER P.A.10/31/2019 603-6303-4300 2019-2020 Legislative Representation 6,600.00 MESSERLI & KRAMER P.A. 6,600.00 MN VALLEY ELECTRIC COOP 10/24/2019 101-1350-4320 electricity charges 107.61 MN VALLEY ELECTRIC COOP 10/31/2019 101-1350-4320 Electricity charges 32.54 MN VALLEY ELECTRIC COOP 10/31/2019 101-1350-4320 Electricity charges 126.90 MN VALLEY ELECTRIC COOP 267.05 NAPA AUTO & TRUCK PARTS 10/24/2019 101-1320-4140 wiper blade 3.77 NAPA AUTO & TRUCK PARTS 10/24/2019 700-0000-4120 fuel filter 8.22 NAPA AUTO & TRUCK PARTS 10/24/2019 101-1320-4140 oxygen sensor 72.55 NAPA AUTO & TRUCK PARTS 84.54 NYSTROM PUBLISHING COMPANY INC 10/31/2019 101-1120-4330 Connection publication-postage 1,935.10 NYSTROM PUBLISHING COMPANY INC 10/31/2019 101-1110-4340 Connection publication 6,238.94 NYSTROM PUBLISHING COMPANY INC 8,174.04 OPEN AND SHUT ENTERPRISES INC 10/24/2019 101-1190-4510 library door-service labor 1,572.00 OPEN AND SHUT ENTERPRISES INC 1,572.00 Pedretti Christine Lea 10/31/2019 101-1539-4300 Yoga instruction-Sept/Oct 2019 720.20 Pedretti Christine Lea 720.20 POMP'S TIRE SERVICE INC 10/31/2019 101-1320-4140 tires 526.44 POMP'S TIRE SERVICE INC 10/31/2019 101-1550-4140 tires 2,723.04 POMP'S TIRE SERVICE INC 3,249.48 Premium Waters, Inc 10/24/2019 101-1550-4120 monthly fee-October 12.30 Premium Waters, Inc 12.30 RBM SERVICES INC 10/24/2019 101-1170-4350 nightly janitorial 3,583.37 RBM SERVICES INC 10/24/2019 101-1190-4350 nightly janitorial-library 3,471.10 RBM SERVICES INC 7,054.47 Safe-Fast, Inc.10/31/2019 101-1320-4240 sweatshirts 65.90 Safe-Fast, Inc. 65.90 SNAP-ON INDUSTRIAL 10/31/2019 101-1370-4260 6in flush cutting pliers 35.94 SNAP-ON INDUSTRIAL 10/31/2019 700-0000-4260 1/2dr 80t std lck rat 119.33 Accounts Payable - Check Detail-ACH (11/01/2019 - 12:17 PM)Page 3 of 6 Name Check Da Account Description Amount SNAP-ON INDUSTRIAL 155.27 SUBURBAN CHEVROLET 10/24/2019 101-1320-4140 seal/tube 40.50 SUBURBAN CHEVROLET 40.50 Sun Life Financial 10/24/2019 101-0000-2011 Life insurance-cobra 5.95 Sun Life Financial 10/24/2019 101-1120-4040 Life insurance 32.56 Sun Life Financial 10/24/2019 101-1130-4040 Life insurance 12.59 Sun Life Financial 10/24/2019 101-1160-4040 Life insurance 11.21 Sun Life Financial 10/24/2019 101-1250-4040 Life insurance 45.36 Sun Life Financial 10/24/2019 101-1310-4040 Life insurance 30.28 Sun Life Financial 10/24/2019 101-1320-4040 Life insurance 48.25 Sun Life Financial 10/24/2019 101-1370-4040 Life insurance 19.10 Sun Life Financial 10/24/2019 101-1520-4040 Life insurance 13.50 Sun Life Financial 10/24/2019 101-1530-4040 Life insurance 6.21 Sun Life Financial 10/24/2019 101-1560-4040 Life insurance 5.13 Sun Life Financial 10/24/2019 101-1600-4040 Life insurance 6.89 Sun Life Financial 10/24/2019 101-1700-4040 Life insurance 0.77 Sun Life Financial 10/24/2019 101-1550-4040 Life insurance 39.68 Sun Life Financial 10/24/2019 101-1420-4040 Life insurance 34.58 Sun Life Financial 10/24/2019 101-1430-4040 Life insurance 2.05 Sun Life Financial 10/24/2019 210-0000-4040 Life insurance 7.65 Sun Life Financial 10/24/2019 720-7201-4040 Life insurance 2.43 Sun Life Financial 10/24/2019 720-7202-4040 Life insurance 2.43 Sun Life Financial 10/24/2019 101-1170-4040 Life insurance 3.51 Sun Life Financial 10/24/2019 101-1220-4040 Life insurance 18.72 Sun Life Financial 10/24/2019 701-0000-4040 Life insurance 31.51 Sun Life Financial 10/24/2019 700-0000-4040 Life insurance 40.86 Sun Life Financial 10/24/2019 720-0000-4040 Life insurance 9.48 Sun Life Financial 10/24/2019 101-0000-2011 Life insurance 781.92 Sun Life Financial 10/24/2019 210-0000-2011 Life insurance 6.29 Sun Life Financial 10/24/2019 700-0000-2011 Life insurance 109.52 Sun Life Financial 10/24/2019 701-0000-2011 Life insurance 109.52 Sun Life Financial 10/24/2019 720-0000-2011 Life insurance 9.00 Sun Life Financial 1,446.95 ULTIMATE CONTROLS ELECTRIC LLC 10/31/2019 700-0000-4530 install new chlorine analyzer in LS 26 1,132.50 ULTIMATE CONTROLS ELECTRIC LLC 1,132.50 UNITED WAY 10/24/2019 101-0000-2006 PR Batch 00425.10.2019 United Way 29.40 UNITED WAY 29.40 WAYTEK INC 10/24/2019 101-1550-4120 flanged block spade/female disconnect/toggle switch 108.95 WAYTEK INC 108.95 WM MUELLER & SONS INC 10/31/2019 420-0000-4751 1/4" fine mix 685.95 WM MUELLER & SONS INC 10/24/2019 420-0000-4751 1/4" fine mix 340.00 WM MUELLER & SONS INC 10/24/2019 420-0000-4751 class 5 gravel/1" minus 1,510.36 WM MUELLER & SONS INC 10/24/2019 420-0000-4751 1/4" fine mix 684.25 WM MUELLER & SONS INC 10/24/2019 101-1550-4150 lundquist cy 168.00 Accounts Payable - Check Detail-ACH (11/01/2019 - 12:17 PM)Page 4 of 6 Name Check Da Account Description Amount WM MUELLER & SONS INC 10/24/2019 700-0000-4552 lundquist cy 56.00 WM MUELLER & SONS INC 10/31/2019 420-0000-4751 1/4" fine mix 339.15 WM MUELLER & SONS INC 3,783.71 WSB & ASSOCIATES INC 10/31/2019 101-1310-4300 2019 GIS/AMS Support services 667.80 WSB & ASSOCIATES INC 10/31/2019 700-0000-4300 2019 GIS/AMS Support services 417.38 WSB & ASSOCIATES INC 10/31/2019 701-0000-4300 2019 GIS/AMS Support services 417.37 WSB & ASSOCIATES INC 10/31/2019 720-0000-4300 2019 GIS/AMS Support services 166.95 WSB & ASSOCIATES INC 10/31/2019 420-0000-4300 Carver County TH5 Regional Trail 351.50 WSB & ASSOCIATES INC 10/31/2019 720-0000-4300 6760 Minnewashta Pkwy Delin Review 444.00 WSB & ASSOCIATES INC 10/31/2019 101-1310-4300 GIS Support Services 1,972.00 WSB & ASSOCIATES INC 10/31/2019 700-0000-4300 GIS Support Services 1,232.50 WSB & ASSOCIATES INC 10/31/2019 701-0000-4300 GIS Support Services 1,232.50 WSB & ASSOCIATES INC 10/31/2019 720-0000-4300 GIS Support Services 493.00 WSB & ASSOCIATES INC 10/31/2019 420-0000-4300 2019 Pavement Management-Roads 3,619.00 WSB & ASSOCIATES INC 10/31/2019 420-0000-4300 2019 Pavement Management Trail 4,370.50 WSB & ASSOCIATES INC 10/31/2019 601-6038-4752 Orchard Lane Street & Utility Reconstruction 4,338.00 WSB & ASSOCIATES INC 10/31/2019 700-7050-4752 West Water Treatment Plant 1,429.50 WSB & ASSOCIATES INC 10/31/2019 601-6033-4752 Street Reconstruction Project 16-01 1,607.00 WSB & ASSOCIATES INC 10/31/2019 720-0000-4300 Moments WCA Review 185.00 WSB & ASSOCIATES INC 10/31/2019 720-0000-4300 2019 SWAMP subscription 3,000.00 WSB & ASSOCIATES INC 10/31/2019 601-6039-4752 Lake Drive East Street Imp Project 18-02 19,208.00 WSB & ASSOCIATES INC 45,152.00 WW GRAINGER INC 10/24/2019 101-1190-4260 drill bit/chain switch/traffic cone 42.30 WW GRAINGER INC 42.30 XCEL ENERGY INC 10/24/2019 700-7043-4320 electricity charges 6,581.91 XCEL ENERGY INC 10/24/2019 101-1350-4320 electricity charges -1.89 XCEL ENERGY INC 10/24/2019 101-1350-4320 electricity charges 16.26 XCEL ENERGY INC 10/24/2019 700-7019-4320 electricity charges 2,569.96 XCEL ENERGY INC 10/24/2019 700-0000-4320 electricity charges 5,117.92 XCEL ENERGY INC 10/31/2019 701-0000-4320 electricity charges -135.08 XCEL ENERGY INC 10/31/2019 700-0000-4320 electricity charges -327.68 XCEL ENERGY INC 10/31/2019 101-1350-4320 electricity charges 18,131.82 XCEL ENERGY INC 10/31/2019 101-1600-4320 electricity charges 22.64 XCEL ENERGY INC 10/31/2019 101-1540-4320 electricity charges 562.18 XCEL ENERGY INC 10/31/2019 101-1600-4320 electricity charges 56.50 XCEL ENERGY INC 10/31/2019 101-1550-4320 electricity charges -118.83 XCEL ENERGY INC 10/31/2019 101-1170-4320 electricity charges -43.39 XCEL ENERGY INC 10/31/2019 101-1190-4320 electricity charges 910.20 XCEL ENERGY INC 10/31/2019 101-1220-4320 electricity charges 1,087.01 XCEL ENERGY INC 10/31/2019 101-1370-4320 electricity charges 1,755.06 XCEL ENERGY INC 10/31/2019 101-1171-4320 electricity charges 12.95 XCEL ENERGY INC 10/31/2019 700-0000-4320 electricity charges 219.38 XCEL ENERGY INC 10/31/2019 701-0000-4320 electricity charges 219.38 XCEL ENERGY INC 10/31/2019 101-1600-4320 electricity charges 12.16 XCEL ENERGY INC 10/31/2019 101-1350-4320 electricity charges 97.58 XCEL ENERGY INC 10/31/2019 101-1350-4320 electricity charges 12.21 XCEL ENERGY INC 10/31/2019 101-1600-4320 electricity charges -6.09 XCEL ENERGY INC 10/31/2019 101-1350-4320 electricity charges 11.32 XCEL ENERGY INC 10/31/2019 101-1350-4320 electricity charges 11.32 Accounts Payable - Check Detail-ACH (11/01/2019 - 12:17 PM)Page 5 of 6 Name Check Da Account Description Amount XCEL ENERGY INC 10/31/2019 700-0000-4320 electricity charges 20.98 XCEL ENERGY INC 36,795.78 501,525.52 Accounts Payable - Check Detail-ACH (11/01/2019 - 12:17 PM)Page 6 of 6 CITY COUNCIL STAFF REPORT Tuesday, November 12, 2019 Subject Building Permit Data as of 11012019 Section CORRESPONDENCE DISCUSSION Item No: K.2. Prepared By Bob Generous, Senior Planner File No: ATTACHMENTS: Building Permit Data 11022019 11tlt20192019BUILDING PERIVIT DATA Subtotal Amusment Works OR 319 I Itm =Pmirs I-- 2l I I l 2 ----.t - =I I I Ilz 2 2 JIJLY 6 t2 I 6 6 3 3 3 SEPTEMBER 5 5 5 5 5 43 0 -l 0 35 I 35 38 $0 $0 $r Subtotal Residential OR MORE 6 7 99 "l 87 I 93 I #DM0! 9 6 I tl 71 #DM0! I 4 I $0 $ll #DMo! 6 83 88 2 I $0 #DM0! $0 #DTV/OI #DTV/OI #DM0! 50 798 9 ,7 743 199 0 I $0 I \\cfss\cfs5\Shared_Data\PLAN\CENSUS\RPT 201 9 !!iE 2 2 - @ 3 - - f-L UdE L L I Lr-trIf-T- Bld* - Ulil - - a CITY COUNCIL STAFF REPORT Tuesday, November 12, 2019 Subject 2019 Building Permit Activity through 1112019 Section CORRESPONDENCE DISCUSSION Item No: K.3. Prepared By Bob Generous, Senior Planner File No: ATTACHMENTS: 2019 Building Permit Activity through 1112019 City of Chanhassen 7700 Market Bouleva Chanhassen, MN 55 952-227-1100 2019 Building Permit Activity Thru Nov. lr20l9 35511l54Residential Single-FamilY 1806t20Residential Townhomes 00000Apartments/S enior Facilities 5352274Total Residential 30J00New II000Redeveloped 50320t4l3Remodeled 54423l4l3Total Commercial 125758199Single-Family Lots 2443496lResidential Townhome Lots 149r18130160Total Available Lots 49554810057Single-Family 56t20496 26807600Apartments/S enior Facilities 586710910982Commercial 431134233213235Total Number of All Permits \\cfs5\cfs5\shared-data\admin\forms\building permit activity 2019 yd'doc Residential Buitding Permits l't Quarter 2nd Quarter 3'd Quarter YTD 4th Quarter Total YTD Commercial Building Permits I't Quarter 2nd Quarter 3'd Quarter YTD 4th Quarter Total YTD Available Lot Inventory (end l't Quarter 2"d Quarter 3'd Quarter YTD 4rh Quarter Total Permit HistorY 2014 2015 2016 2017 2018 Townhomes