The URL can be used to link to this page

CAS-03_2018-03 CUP AMEND 7700 QUATTRO DRIVECITYOFCHANHASSEN Chanhassen is Community for Ufe- Providing forToday and Planning forTomorrow February 13, 2018 Crown Castle Services Mr. Richard Krueger 1600 Utica Ave. S., STE 475 St. Louis Park, MN 55416 Re: Planning Case #2018-03 Dear Mr. Krueger; This letter is to confirm that the City Council approved the amendment to Conditional Use Permit #2000- 06 to permit the construction of an extension of the communication tower up to 90 feet monopole, plans prepared by Design 1, dated revised April 4, 2017, subject to the following conditions: 1. A building permit is required to construct the platform and tower extension; the tower must be designed for a 90 MPH wind load and include the effect of one-half inch of radial ice. 2. The original plans must be signed by a professional engineer licensed in the State of Minnesota. 3. The contractor shall meet with the Inspections Division as early as possible to discuss plan review and permit procedures. 4. The applicant shall submit a detailed grading, drainage, and erosion control plan for staff review and approval. 5. The tower extension shall be of the same color as the existing tower. 6. A letter of intent committing the tower owner and his or her successors to allow the shared use of the tower if an addition user agrees in writing to meet reasonable terms and conditions for shared use shall be submitted to the city. You will need to submit a building permit application for the extension, platform and fence. If you have any questions or need more information, please contact me at (952) 227-1131 or b enerous ,ei.chanhassen.mn.us. Robert Generous, AICP Senior Planner c: Marilyn Beddor ec: Kate Aanenson, Community Development Director Jessica Archer, Building Official George Bender, Assistant City Engineer Todd Gerhardt, City Manager PH 952.227.1100 • wwwAchallhassen.mn.uS • FX 952.227.1110 7700 MARKET BOULEVARD • PO BOX 147 • CHANHASSEN • MINNESOTA 55317 10 M 1 f 1 ►F[►r I mow. 11 1 I♦ d /1�1 i': t 1 r !+ Disclaimer This map is neither a legally recorded map nor a survey and is not intended to be used as one This map is a compilation of records, information and data located in various city, county, state and federal offices and other sources regarding the area shown, and is to be used for reference purposes only. The City does not warrant that the Geographic Information System (GIS) Data used to prepare this map are error free, and the City does not represent that the GIS Data can be used for navigational, tracking or any other purpose requiring exacting measurement of distance or direction or precision in the depiction of geographic features. If errors or discrepancies are found please contact 952-227-1107 The preceding disclaimer is provided pursuant to Minnesota Statutes §466.03, Subd 21 (2000), and the user of this map acknowledges that the City shall not be liable for any damages, and expressly waives all claims. and agrees to defend, indemnity, and hold harmless the City from any and all claims brought by User, its employees or agents, or third parties which, apse out Of the 4r use of data provided �8 0� ASiS �� PITNEY BOWER 02 1 P $ 000.460 r 0003195036 JAN 042018 CITY OF MAILED FROM ZIP CODE 5531 CHANHASSEN 7700 Market Boulevard P.O. Box 147 lb Chanhassen, Minnesota 55317 www.ci.chanhassen.mn.us a 1a6 �p pR�Ro m596g' 3L BANTA DIRECT MARKETING GROUP 300 LANG BLVD GRAND ISLAND NY 14072 Notice of Public Hearing Chanhassen Planning Commission Meeting Date & Time: Tuesday, January 16, 2018 at 7:00 P.M. This hearing may not start until later in the evening, depending on the order of the agenda, Location: City Hall Council Chambers, 7700 Market Blvd. Request to consider an amendment to the Conditional Use Proposal: Permit to expand a communication tower on property located at 7700 Quattro Drive and zoned Industrial Office Park District (lop). Applicant: Crown Castle Services Property 7700 Quattro Drive Location: A location map is on the reverse side of this notice. The purpose of this public hearing is to inform you about the �plicant's request and to obtain input from the neighborhood .gout this project. Curing the meeting, the Chair will lead the What Happens Public hearing through the following steps: at the Meeting: 1. Staff will give an overview of the proposed project. 2. The applicant will present plans on the project. 3. Comments are received from the public. 4. Public hearing is closed and the Commission discusses the project. _ If you want to see the plans before the meeting, please visit the City's projects web page at. www.ci.chanhassen.mn.us/2018-03. If you wish to talk to someone about this project, please contact Bob Generous by Questions & email at bgenerous(a_)ci.chanhassen.mn.us or by phone at Comments: 952-227-1131. If you choose to submit written comments, it is helpful to have one copy to the department in advance of the meeting. Staff will provide copies to the Commission. The staff report for this item will be available online on the project web site listed above the Thursday prior to the j Planning Commission meeting. NEW! Sign up to receive email and/or text notifications when meeting agendas, ' . ckets, minutes and videos are uploaded to the city's website. Go to ci.chanhassen.mn.us/notifyme to sign up! Vft Review Procedure: • ubdivisions, Planned Unit Developments, Site Plan Reviews, Conditional and Interim Uses, Wetland Alterations, Rezomngs, Comprehensive Plan Amendments and Code Amendments require a public hearing before the Planning Commission City ordinances require all property within 500 feet of the subject site to be notified of the application in writing. Any interested party is invited to attend the meeting • Staff prepares a report on the subject application that includes all pertinent information and a recommendation These reports are available by request. At the Planning Commission meeting, staff will give a verbal overview of the report and a recommendation The Item will be opened for the public to speak about the proposal as a part of the hearing process. The Commission will dose the public hearing and discuss the item and make a recommendation to the City Council The City Council may reverse, affirm or modify wholly or partly the Planning Commission's recommendation. Rezonings land use and code amendments take a simple majority vote of the City Council except rezornngs and land use amendments from residential to commercial/industrial • Minnesota State Statute 519.99 requires all applications to be processed within 60 days unless the applicant waives this standard Some applications due to their complexity may take several months to complete Any person wishing to follow an Item through the process should check with the Planning Department regarding its status and scheduling for the City Council meeting. • A neighborhood spokesperson/representative is encouraged to provide a contact for the city. Often developers are encouraged to meet with the neighborhood regarding their proposal Staff is also available to review the project with any interested person(s) • Because the Planning Commission holds the public hearing, the City Council does not Minutes are taken and any correspondence regarding the application will be included In the report to the City Council. 11 you wish to have something to be included in the report, lease contact the Planning Staff person named on the notification. IN CITY OF CHANHASSEN CARVER AND HENNEPIN COUNTIES, MINNESOTA FINDINGS OF FACT AND RECOMMENDATION IN RE: Application of Golf Lakes Condos, LLC for an amendment to the Planned Unit Development - Residential, PUD-R zoning ordinance — Arbor Glen — Planning Case #2018-06 (formerly #2015- 19). On February 20, 2018, the Chanhassen Planning Commission met at its regularly scheduled meeting to consider the application of Golf Lakes Condos, LLC Consider an amendment to the Arbor Glen Planned Unit Development - Residential (PUD-R) design standards regarding permissible lot coverage and driveway locations. The Planning Commission conducted a public hearing on the proposed amendment preceded by published and mailed notice. The Planning Commission heard testimony from all interested persons wishing to speak and now makes the following: FINDINGS OF FACT 1. The property is currently zoned Planned Unit Development — Residential, PUD-R. 2. The property is guided in the Land Use Plan for Residential — Low Density use. 3. The legal description of the property is: All the Lots and Blocks and Outlots, except Outlot E, of Arbor Glen, Carver County, Minnesota. 4. The Zoning Ordinance directs the Planning Commission to consider six (6) possible adverse affects of the proposed amendment. The six (6) affects and our findings regarding them are: a. The proposed action has been considered in relation to the specific policies and provisions of and has been found to be consistent with the official City Comprehensive Plan. b. The proposed use is compatible with the present and future land uses of the area. c. The proposed use conforms with all performance standards contained in the Zoning Ordinance subject to the granting of the setback variance. d. The proposed use will not tend to or actually depreciate the area in which it is proposed. e. The proposed use can be accommodated with existing public services and will not overburden the city's service capacity. 1 f. Traffic generation by the proposed use is within capabilities of streets serving the property. The planning report #2018-06 dated February 20, 2018, prepared by Robert Generous, et al, is incorporated herein. RECOMMENDATION The Planning Commission recommends that the City Council approve an amendment to the Planned Unit Development - Residential, PUD-R zoning ordinance. ADOPTED by the Chanhassen Planning Commission this 20'h day of February, 2018. CHANHASSEN PLANNING COMMISSION BY: Andrew Aller, Its Chairman \1cfs5\cfs5Whared_data\p1an\2018 pkmning cases\18-06 - arbor glen pud amendment\findings of fact.doc 2 All �S- a3 CITY OF CHANHASSEN CARVER AND HENNEPIN COUNTIES, MINNESOTA FINDINGS OF FACT AND RECOMMENDATION IN RE: Application of Crown Castle Services and Marilyn Beddor for an amendment to a Conditional Use Permit for a communication tower extension on property zoned Industrial Office Park. On January 16, 2018, the Chanhassen Planning Commission met at its regularly scheduled meeting to consider the application. The Planning Commission conducted a public hearing on the proposed conditional use permit preceded by published and mailed notice. The Planning Commission makes the following: FINDINGS OF FACT 1. The property is currently zoned Industrial Office Park, IOP. 2. The property is guided in the Chanhassen Comprehensive Plan for Office Industrial uses. The legal description of the property is Lot 1, Block 1, Quattro Addition, Hennepin County, Minnesota. 4. When approving a conditional use permit, the City must determine the capability of a proposed development with existing and proposed uses. The general issuance standards of the conditional use, Section 20-232, include the following 12 items: a. Will not be detrimental to or endanger the public health, safety, comfort, convenience or general welfare of the neighborhood or the city. Finding: The proposed communication tower will not be detrimental to general welfare of the neighborhood. The proposed tower and accompanying equipment building would be compatible with the uses in the industrial park. b. Will be consistent with the objectives of the city's comprehensive plan and this chapter. Finding: The proposed use is consistent with the city's comprehensive plan, ordinance requirements for Highway 5 Corridor District, the IOP district regulations, and the tower ordinance. c. Will be designed, constructed, operated and maintained so to be compatible in appearance with the existing or intended character of the general vicinity and will not change the essential character of that area. do i' Finding: The proposed tower and accompanying equipment building would be compatible with the uses in the industrial park. The location minimizes adverse visual effects of towers through careful design and siting standards which attempt to screen and or camouflage towers from adjacent public and private property. d. Will not be hazardous or disturbing to existing or planned neighboring uses. Finding: The proposed tower will not be hazardous to existing or planned neighboring uses. e. Will be served adequately by essential public facilities and services, including streets, police and fire protection, drainage structures, refuse disposal, water and sewer systems and schools; or will be served adequately by such facilities and services provided by the persons or agencies responsible for the establishment of the proposed use. Finding: The proposed development is provided with adequate public services. f. Will not create excessive requirements for public facilities and services and will not be detrimental to the economic welfare of the community. Finding: The proposed development will not require excessive public services. The proposed tower extension will not be detrimental to the economic welfare of the community. g. Will not involve uses, activities. processes, materials, equipment and conditions of operation that will be detrimental to any persons, property or the general welfare because of excessive production of traffic, noise, smoke, fumes, glare, odors, rodents, or trash. Finding: The proposed tower should not create conditions that are detrimental to persons, property or the general welfare of the community. h. Will have vehicular approaches to the property which do not create traffic congestion or interfere with traffic or surrounding public thoroughfares. Finding: The proposed development will not interfere with traffic circulation. i. Will not result in the destruction, loss or damage of solar access, natural, scenic or historic features of major significance. Finding: The proposed development will not destroy or damage natural, scenic, or historic features. J. Will be aesthetically compatible with the area. Finding: The proposed tower will be aesthetically compatible with the area. It extends an existing communication tower. 2 k. Will not depreciate surrounding property values. Finding: The proposed development should not depreciate surrounding property values. 1. Will meet standards prescribed for certain uses as provided in this article. Finding: The proposed development meets standards established for communication towers. 5. The planning report #2018-03, dated January 16, 2018, prepared by Robert Generous, et al, is incorporated herein. RECOMMENDATION The Planning Commission approves an amendment to the conditional use permit to permit the extension of the communication tower. ADOPTED by the Chanhassen Planning Commission this 16th day of January, 2018. CITY OF CHANHASSEN B'k Chairman gAplan\2018 planning cases\18-03 - 7700 gttattro dr\findings of fact quattro.doc �-v3 Planning Commission — January 16, 2018 Aller: Motion carries unanimously. Thank you again sir. Richard LaMettry: Nothing to it. PUBLIC HEARING: 7700 QUATTRO DRIVE — CONDITIONAL USE PERMIT AMENDMENT TO EXTEND COMMUNICATION TOWER. Generous: Thank you Chairman and commissioners. Again this is an amendment to an existing conditional use permit. They were approved for a 75 foot tower. As a condition of approval they were required to construct it so that it could be extended in the future to accommodate another set of antennas. However it was too short. Again this is a public hearing. This will go to City Council on February 12`''. The applicant is Crown Castle Services and the property owner if Marilyn Beddor. This property is located at 7700 Quattro Drive. That's actually in Hennepin County. It's just north of Highway 5 and east of Dell Road. There's an existing cell tower in the back yard and the property is zoned industrial office park. It's over 2 acres in size. The location of the tower meets all our zoning requirements. Again the existing tower and equipment are behind the building, the northerly building on the site so they're not visible from the public right-of-way. They would be adding 15.2 feet to the height of the tower and an additional 3 feet on top of that for a lightning rod. They will be putting in additional equipment platform on the rear and then they're going to enclose that with a fence system. (Due to technical difficulties a portion of the staff report and the applicant's presentation were not recorded.) Richard Krueger: ... so yeah this is definitely no, yeah. Tietz: Taken into consideration. Richard Krueger: Absolutely yeah. Tietz: That was the only thing I was concerned with. With an aging, for an 18 year old structure and. Richard Krueger: Right, yeah they'll do welding and there's welding standards and stuff like that on the flange plate and all that kind of stuff so yeah. It's, if it were to fail -it would be very bad for the company and the public and you don't hear about cell towers falling over for that reason. It's very safe so. Yeah there'll be, an act of God would have to happen basically. A 100 year flood down in Texas or something like that so yeah there's a lot of testing that goes along with that. Tietz: Good, thanks. 9 Sl� 14�` �,k�J 16 Planning Commission — January 16, 2018 Richard Krueger: Yeah no problem. Aanenson: I was just going to add on that too Planning Commission members that those permits will be reviewed by the City so they have to submit those engineering reports so, before a permit would be issued to work on it. Tietz: Good, thanks. Aller: Based on the commissioners question or the response any additional comments or questions for the applicant? Seeing none. Oh Commissioner Madsen. Madsen: I just see in our packet that the ordinance would allow for a taller tower. Do you anticipate in the future that to make it taller or could you add additionally at a later point in time? Richard Krueger: I think if they really wanted to do it. The impetus for this is Verizon, the carrier came to us and said we wanted coverage in this area. We looked at the tower. It says well we don't have what we call a center line, RAD center line radio distribution center line so we're going to extend the tower so the reason why we're doing this right now, to this height is because it's the most economically feasible one and frankly I'm not an engineer. I went to law school. I don't know like the calculations and stuff like that but I'm guessing that if it got a little bit, if it got too tall that's when we run into issues with structural integrity and also legislatively speaking there's a 6409A passed by the U.S. government says you can go up to 20 feet. It's called an eligible facilities request which this is so anything under 20 feet is not a substantial change to the tower and there's other criteria too but if we're talking about height it's under 20 feet so they like to keep it underneath that no matter what because the cost benefit analysis, it wouldn't really work to extend it another 10 feet and then run into an issue where it's like, instead of going to 87 or 90 we're going to 100 or 105 or something like that. It's just more spooky. We're getting into triple digits there so, as far as coming back and extending it, I don't see that happening. But if it was to be the case that would be 20 years from now and by that time everything will be small cell anyways so. Madsen: Okay, thank you. Richard Krueger: Yeah no problem. Aller: Great, thank you very much. Just a follow up for staff. The conditions are requiring a building permit which will allow for a 90 foot tower and the structure would have to be substantially fit for 90 feet. Generous: Correct, it would have to meet the 90 miles an hour wind load and then the half inch of ice so. 10 Planning Commission — January 16, 2018 Aller: If they were to come back how high would it be for purposes of an administrative request as opposed to coming before us again. Generous: We only get 10 percent so 9 feet. Aller: Thank you. Now we'll open up the public hearing portion of the item. Any individuals wishing to come forward can speak for or against the tower issue before us. Seeing no one come forward we'll close the public hearing and comments or action. Randall: I have no comments. Madsen: Looks good. Aller: I'll invite a motion then. Madsen: I'll make a motion. Aller: Commissioner Madsen. Madsen: The Chanhassen Planning Commission recommends approval of the amendment to the Conditional Use Permit to permit the extension of the communication tower and approves the Findings of Fact and Recommendation. Aller: I have a motion. Do I have a second? Randall: Second. Aller: Thank you Commissioner Randall. I have a motion and a second. Any further discussion? Madsen moved, Randall seconded that the Chanhassen Planning Commission recommends approval of an amendment to Conditional Use Permit #2000-6 to permit the construction of an extension to the communication tower up to 90 feet monopole, plans prepared by Design 1, dated revised 04-10-17, and subject to the following conditions and adopts the Findings of Fact and Recommendation: 1. A building permit is required to construct the platform and tower extension; the tower must be designed for a 90 MPH wind load and include the effect of one-half inch of radial ice. 2. The original plans must be signed by a professional engineer licensed in the State of Minnesota. Planning Commission — January 16, 2018 3. The contractor shall meet with the Inspections Division as early as possible to discuss plan review and permit procedures. 4. The applicant shall submit a detailed grading, drainage and erosion control plan for staff review and approval. 5. The tower extension shall be of the same color as the existing tower. 6. A letter of intent committing the tower owner and his or her successors to allow the shared use of the tower if an additional user agrees in writing to meet reasonable terms and conditions for shared use shall be submitted to the City. All voted in favor and the motion carried unanimously with a vote of 4 to 0. PUBLIC HEARING: 7555 WALNUT CURVE — VARIANCE TO BUILD A POOL. Walters: Alright this is Planning Case 2018-04, 7555 Walnut Curve. If appealed this would go before the City Council on February 121h. The applicant is requesting a 4.9 percent lot coverage variance for the construction of an in ground swimming pool and pool apron area. So it's located in the Walnut Grove subdivision on 7555 Walnut Curve. This is a planned unit development. It has a minimum lot size of 10,400 square feet and then 30 foot front and rear setbacks. 10 foot, I'm sorry that should read 10 foot side setback and this zone, this PUD has a 30 percent lot coverage but properties within the shoreland overlay district are limited to 25 percent. This property is located within the shoreland overlay district due to the presence of a mapped stream or creek in the field to the east. There are 4 houses within the planned unit development, 4 single family homes within the planned unit development that are subject to this 25 percent limit. The property has a 14,283 square foot lot. There's currently 26.4 percent lot coverage and it meets all required setbacks. The applicant is proposing to construct an 18 foot by 36 foot sport pool with a 566 square foot pool apron/patio area. They are proposing to install a rain garden in the southwest corner of the lot in order to capture a lot of the pool runoff. The property naturally drains towards that comer away from the stream so their rationale is most other similar properties within the PUD would be allowed the 30 percent. The intent of the shoreland management zone of protecting the creek can be met due to the grading of the lot even with the higher percentage and the applicant is planning on installing the rain garden and also an additional rain barrel to minimize runoff and impact on the stream. When staff looked at it water resources agreed with our assessment of the grading with the exception that they noticed that there's a slightly lower dip here and they believe that if a one foot berm is constructed here to bring it all up to 1,000 foot elevation that it would then function as intended and direct any potential runoff away from that stream or creek. As you can see the creek is, looks to be pretty much plowed under in the field. We're not exactly certain where it is there but it is, it does exist on the map so that does trigger the shoreland overlay district. Staff does believe that the intent of the overlay district of protecting the creek can be met through grading and through the use of the 12 CITY OF CHANHASSEN CARVER & HENNEPIN COUNTIES NOTICE OF PUBLIC HEARING PLANNING CASE NO. 2018-03 NOTICE IS HEREBY GIVEN that the Chanhassen Planning Commission will hold a public hearing on Tuesday, January 16, 2018 at 7:00 p.m. in the. Council Chambers in Chanhassen City Hall, 7700 Market Blvd. The purpose of this hearing is to consider an amendment to the Conditional Use Permit to expand a communication tower on property located at 7700 Quattro Drive and zoned Industrial Office Park District (IOP). Applicant: Crown Castle Services Owner: Marilyn Beddor. A plan showing the location of the proposal is available for public review on the city's web site at wwwci.chanhassen. mn.us/2018-03 or at City Hall during regular business hours. All interested persons are invited to attend this public hearing and express their opinions with respect to this proposal. Robert Generous, AICP Email: bgenerous@ ei.0 anhassen.mn.us Phone: 952-227-1131 (Published in the Chanhassen Villager on Thursday, January 4, 2018; No. 4545) Affidavit of Publication Southwest Newspapers State of Minnesota) )SS. County of Carver ) Laurie A. Hartmann, being duly sworn, on oath says that she is the publisher or the authorized agent of the publisher of the newspapers known as the Chaska Herald and the Chanhassen Vil- lager and has full knowledge of the facts herein stated as follows: (A) These newspapers have complied with the requirements constituting qualification as a legal newspaper, as provided by Minnesota Statute 331A.02, 331A.07, and other applicable laws, as amended. (B) The printed public notice that is attached to this Affidavit and identified as No. was published on the date or dates and in the newspaper stated in the attached Notice and said Notice is hereby incorporated as part of this Affidavit. Said notice was cut from the columns of the newspaper specified. Printed below is a copy of the lower case alphabet from A to Z, both inclusive, and is hereby acknowledged as being the kind and size of type used in the composition and publication of the Notice: abcdefghijklmnopgrstuvwxyz Subscribed and sworn before me on Laurie A. Hartmann ee:WN rrmm D JYMME JEANNETTE BARK OTARY PUBUC • MINNESOTA COMMISSION EXPIRES 01131/23 RATE INFORMATION Lowest classified rate paid by commercial users for comparable space.... $31.20 per column inch Maximum rate allowed by law for the above matter ................................. $31.20 per column inch Rate actually charged for the above matter ............................................... $ 12.97 per column inch SONS" 41 Hennepin County Property Information Search Version * 1.2014.5 Page 2 of 4 Search By: Parcel Data for Taxes Payable 2017 F2018 ■ Current year taxes due proposed property tax (Truth In Taxation statement) ■ View map of property ■ Current year values ■ Prior year taxes ■ Print details The Hennepin County Property Tax web database is updated daily (Monday - Friday) at approximately 9:15 p.m. (CST) Property ID: 07-116-22-34-0018 Address: 7700 QUATTRO DR Municipality: CHANHASSEN School Dist: 272 Construction year: 1988 Watershed: 4 Approx. Parcel Size: E309X301X352X310 Sewer Dist: Owner Name: BEDDOR ENTERPRISES Taxpayer Name BEDDOR ENTERPRISES & Address: P O BOX 489 CHANHASSEN MN 55317 Sale Information Sales prices are reported as listed on the Certificate of Real Estate Value and are not warranted to represent arms -length transactions. Sale Date: March, 1996 Sale Price: $300,000 c http://wwwl6.co.hennepin.mn.us/pins/addrresult jsp 12/26/2017 Hennepin County Property Information Search Version * 1.2014.5 Page 3 of 4 Transaction Type: Tax Parcel Description The following is the County Auditor's description of this tax parcel. It may not be the legal description on the most recent conveyance document recording ownership. Please refer to the legal description of this property on the public record when preparing legal documents for recording Addition Name: Lot: Block: First Line Metes & Bounds: Full Metes & Bounds: Abstract or Torrens: QUATTRO ADDITION 001 001 ABSTRACT Value and Tax Summary for Taxes Payable 2017 Values Established by Assessor as of January 2, 2016 Estimated Market Value: Taxable Market Value: Total Improvement Amount: Total Net Tax: $770,000 $770,000 $26,064.96 Expand for details Total Special Assessments: $519.32 Solid Waste Fee: Total Tax: $26,584.28 Expand for taxes due Property Information Detail for Taxes Payable 2017 Values Established by Assessor as of January 2, 2016 Values 2 http://wwwl6.co.hennepin.mn.us/pins/addrresult.jsp 12/26/2017 'Hennepin County Property Information Search Version * 1.2014.5 Page 4 of 4 Land Market $326,000 $120,000 Building Market $324,000 Machinery Market Total Market $650,000 $120,000 Qualifying Improvements Veterans Exclusion Homestead Market Value Exclusion Classifications: 1 2 Property Type INDUSTRIAL LAND COMMERCIAL PREFERRED NON PREFERRED Homestead Status NOW NON -HOMESTEAD HOMESTEAD Relative Homestead Agricultural Exempt Status Hennepin County is providing this information as a public service. Tax related questions: taxi nfoPhennepin.us Hennepin County, Minnesota Open aovemment I Privacy I Copyright 2017 http://wwwl6.co.hennepin.mn.us/pins/addrresult.jsp 12/26/2017 Generous, Bob From: Steve Durham <SDurham@edenprairie.org> Sent: Thursday, December 21, 2017 3:22 PM To: Generous, Bob Subject: 7700 Quatro Drive, Chanhassen Minnesota - File #2018-03 CUP Hello Mr. Generous: The City Eden Prairie has received and reviewed the scope of work related to File #2018-03 The City has no comment at this. Thank you for the review opportunity. Sincerely, Steve, D"ha+nl Planner II Planning Department City of Eden Prairie sdurham@edenprairie.org Generous, Bob From: Sent: Nutter, Don Wednesday, December 20, 2017 2:24 PM To: Potter, Jenny; Generous, Bob Subject: RE: Agency Review Request - 7700 Quattro Drive- Planning Case 2018-03 Reviewed — no comments at this time. Don From: Potter, Jenny Sent: Wednesday, December 20, 2017 2:19 PM To: tjeffery@rpbcwd.org; jjeremiah@edenprairie.org; kevin.dockry@hennepin.us Cc: Smith, Stephanie <sbsmith@ci.chanhassen.mn.us>; Bender, George <GBender@ci.chanhassen.mn.us>; Archer, Jessica <JArcher@ci.chanhassen.mn.us>; Nutter, Don <DNutter@ci.chanhassen.mn.us>; Sinclair, Jill <jsinclair@ci.chanhassen.mn.us>; Strong, Vanessa <VStrong@ci.chanhassen.mn.us>; Generous, Bob <bgenerous@ci.chanhassen.mn.us> Subject: Agency Review Request - 7700 Quattro Drive- Planning Case 2018-03 Development Review Agencies, Please review the attached request and respond with your comments (if any) no later than January 4, 2018 to: Bob Generous City of Chanhassen PO Box 147 Chanhassen, MN S5317 952-227-1131 bgenerous@ci.chanhassen.mn.us Replies to this email will be automatically copied to Bob. You can view all the project documents on the City of Chanhassen's webpage by clicking HERE and then on the link labeled Project Documents under the Related Resources heading. Thank you, YEARS Jenny Potter Senior Administrative Support Specialist CITY OF CHANHASSEN PH. 952.227.1106 FX. 952.227.1110 www.ci.chanhassen.mn.us AN COMMUNITY DEVELOPMENT DEPARTMENT Planning Division — 7700 Market Boulevard Mailing Address — P.O. Box 147, Chanhassen, MN 55317 Phone: (952) 227-1130 / Fax: (952) 227-1110 * CITY OFCHANAASSEN AGENCY REVIEW REQUEST LAND DEVELOPMENT PROPOSAL Please review and respond no later than the review response deadline Agency Review Request Date: December 19, 2017 Agency Review Response Deadline: January 4, 2018 Date Application Filed: December 15, 2017 Contact: Contact Phone: Contact Email: Robert Generous, AICP 952-227-1131 bgenerous@ci.chanhassen.mn.us Senior Planner Planning Commission Date: City Council Date: 60-Day Review Period Deadline: January 16, 2018 at 7:00 p.m. February 12, 2018 at 7:00 p.m. February 13, 2018 Application: Consider an amendment to the Conditional Use Permit to expand a communication tower on property located at 7700 Quattro Drive and zoned Industrial Office Park District (IOP). Applicant: Crown Castle Services Owner: Marilyn Beddor. Planning Case: 2018-03 1 Web Page: www.ci.chanhassen.mn.us/2018-03 In order for staff to provide a complete analysis of issues for Planning Commission and City Council review, we would appreciate your comments and recommendations concerning the impact of this proposal on traffic circulation, existing and proposed future utility services, storm water drainage, and the need for acquiring public lands or easements for park sites. street extensions or improvements, and utilities. Where specific needs or problems exist, we would like to have a written report to this effect from the agency concerned so that we can make a recommendation to the Planning Commission and City Council. Your cooperation and assistance is greatly appreciated. City Departments: Federal Agencies: ❑ Attorney ❑ Army Corps of Engineers ® Building Official ❑ US Fish & Wildlife ® Engineer ® Fire Marshal �v p Watershed Districts: ® ❑ Forester Park Director �JiIV,�`U" ❑ Carver County WMO ® Water Resources ❑ ❑ Lower MN River Minnehaha Creek El Law Enforcement C ® Riley -Purgatory -Bluff Creek Carver County Agencies: Alt ❑ t Utilities. Community Development �.�y�f� ❑ Engineer ❑ Cable TV — Mediacom ❑ Environmental Services ❑ Electric — Minnesota Valley ❑ Historical Society ❑ Electric — Xcel Energy ❑ Parks ❑ Magellan Pipeline El &Water Conservation District ❑ Natural Gas — CenterPoint Energy ❑ Phone — CenturyLink State Agencies: ❑ Board of Water & Soil Resources ❑ Health ❑ Historical Society ❑ Natural Resources -Forestry ❑ Natural Resources -Hydrology ❑ Pollution Control ❑ Transportation Adjacent Cities: ❑ Chaska ® Eden Prairie ❑ Jackson Township ❑ Minnetonka ❑ Shorewood ❑ Victoria Adiacent Counties: ® Hennepin ❑ Scott School Districts: ❑ Eastern Carver County 112 ❑ Minnetonka 276 Other Agencies: ❑ Hennepin County Regional Railroad Authority ❑ MN Landscape Arboretum ❑ SouthWest Transit ❑ TC&W Railroad COMMUNITY DEVELOPMENT DEPARTMENT Planning Division — 7700 Market Boulevard CITY OF CfMNSEN Mailing Address — P.O. Box 147, Chanhassen, MN 55317 Phone: (952) 227-1130 / Fax: (952) 227-1110 AGENCY REVIEW REQUEST LAND DEVELOPMENT PROPOSAL L Please review and respond no later than the review response deadline Agency Review Request Date: December 19. 2017 Agency Review Response Deadline: January 4, 2018 Date Application Filed: December 15. 2017 Contact: Contact Phone: Contact Email: Robert Generous. AICP 952-227-1131 bgenerous@ci.chanhassen.mn.us Senior Planner Planning Commission Date: City Council Date: 60-Day Review Period Deadline: January 16. 2018 at 7:00 p.m. February 12. 2018 at 7:00 p.m. February 13. 2018 Application: Consider an amendment to the Conditional Use Permit to expand a communication tower on property located at 7700 Quattro Drive and zoned Industrial Office Park District (IOP). Applicant: Crown Castle Services Owner: Marilyn Beddor. Planning Case: 2018-03 Web Page: www.ci.chanhassen.mn.us/2018-03 In order for staff to provide a complete analysis of issues for Planning Commission and City Council review, we would appreciate your comments and recommendations concerning the impact of this proposal on traffic circulation, existing and proposed future utility services, storm water drainage, and the need for acquiring public lands or easements for park sites, street extensions or improvements, and utilities. Where specific needs or problems exist, we would like to have a written report to this effect from the agency concerned so that we can make a recommendation to the Planning Commission and City Council. Your cooperation and assistance is greatly appreciated. City Departments: Federal Agencies: ❑ Attorney ❑ Army Corps of Engineers ® Building Official ❑ US Fish & Wildlife ® Engineer ® Fire Marshal Watershed Districts: ® El Forester Park Director ❑ Carver County WMO ® Water Resources ❑ Lower MN River El Enforcement El Minnehaha Creek ® Riley -Purgatory -Bluff Creek Carver County Agencies: Utilities: ❑ ❑ Community Development Engineer ❑ Cable TV — Mediacom ❑ Environmental Services ❑ Electric — Minnesota Valley ❑ Historical Society ❑ Electric — Xcel Energy ❑ Parks ❑ Magellan Pipeline ❑ Soil & Water Conservation District ❑ Natural Gas — CenterPoint Energy ❑ Phone — CenturyLink State Agencies: ❑ Board of Water & Soil Resources ❑ Health ❑ Historical Society ❑ Natural Resources -Forestry ❑ Natural Resources -Hydrology ❑ Pollution Control ❑ Transportation Adiacent Cities: ❑ Chaska ® Eden Prairie ❑ Jackson Township ❑ Minnetonka ❑ Shorewood ❑ Victoria Adjacent Counties: ® Hennepin ❑ Scott School Districts: ❑ Eastern Carver County 112 ❑ Minnetonka 276 Other Agencies: ❑ Hennepin County Regional Railroad Authority ❑ MN Landscape Arboretum ❑ SouthWest Transit ❑ TC&W Railroad SCANNED CITY OF CHANHASSEN P O BOX 147 CHANHASSEN MN 55317 12/20/2017 12:09 PM Receipt No. 00366284 CLERK: AshleyM PAYEE: Crown Castle Services- Midwest 2000 Corporate Drive Canonsburg PA 15317- 7700 Quattro Drive- CUP Planning Case 2018-03 ------------------------------------------------------- Sign Permit 200.00 Total 200.00 Cash 0.00 Check 15343 200.00 Change scos" 0.00 CITY OF CHANHASSEN P 0 BOX 147 CHANHASSEN MN 55317 12/19/2017 3:20 PM Receipt No. 00366261 CLERK: AshleyM PAYEE: Crown Castle Services- Midwest 2000 Corporate Drive Canonsburg MN 15317- 7700 Quattro Drive- CUP Planning Case 2018-03 ------------------------------------------------------- Conditional Use Permit 425.00 Recording Fees 50.00 GIS List 48.00 Total 523.00 Cash 0.00 Check 15342 50.00 Check 15341 48.00 Check 15340 425.00 Change 0.00 s-A14N� CITY OF CHANHASSEN 9NH AS0 PROPOSED MOTION: PC DATE: January 16, 2018 CC DATE: February 12, 2018 -z REVIEW DEADLINE: Feb. 13, 2018 CASE #: 2018-03 BY: JA, GB, RG, DN, VS "The Chanhassen Planning Commission recommends approval of the amendment to the Conditional Use Permit to permit the extension of the communication tower, and approves the Findings of Fact and Recommendation." SUMMARY OF REQUEST: Consider an amendment to the Conditional Use Permit to expand a communication tower. LOCATION: 7700 Quattro Drive (Lot 1, Block 1, Quattro Addition) APPLICANT: Crown Castle Services Marilyn Beddor Richard Krueger P. O. Box 489 1600 Utica Ave. S., STE 475 Chanhassen, MN 55317 St. Louis Park, MN 55416 (763) 852-0576 or richard.krueger(a crowncastle.com PRESENT ZONING: Industrial Office Park District (IOP) 2020 LAND USE PLAN: Office Industrial uses SCONEO ACREAGE: 0.023 acres, 1,000 square feet LEVEL OF CITY DISCRETION IN DECISION -MAKING: The city has limited discretion in approving or denying conditional use permits, based on whether or not the proposal meets the conditional use permit standards outlined in the Zoning Ordinance. If the city finds that all the applicable conditional use permit standards are met, the permit must be approved. This is a quasi-judicial decision. Notice of this public hearing has been mailed to all property, owners within 500 feet. Planning Commission 7700 Quattro Drive - Planning Case 2018-03 January 16, 2018 Page 2 of 4 PROPOSAL/SUMMARY The applicant is requesting an amendment to CUP 2000-06 to permit a tower height of 87 feet, which is taller than the 75 feet height originally approved, to allow the co -location of antennas on the tower. APPLICABLE REGULATIONS Section 20-221 through 20-237 Conditional Uses Section 20-287 Communication transmission towers Section 20-907 Height Regulations Section 20-915 Antennas, satellite dishes and amateur radio towers Section 20-794 of the zoning ordinance permits commercial towers as regulated by article XXX as a conditional use in the IOP zoning district. Section 20-1500 through 20-1522 (Article XXX) regulates towers and antennas. BACKGROUND On December 11, 2000, the Chanhassen City Council approved Conditional Use Permit #2000-6 to permit the installation of a communication tower and site plan approval for up to a 75 foot monopole tower and equipment platform. In November 1996, the City of Chanhassen adopted Ordinance 259 pertaining to towers and antennas. This ordinance provided criteria for the design and location of wireless telecommunication facilities in the city. DISCUSSION The applicant is requesting an amendment to the Conditional Use Permit to allow a 15.2 foot tower extension with a three foot lighting rod on top of the existing 68.8 foot tower. Twelve additional antennas shall be installed on the tower with three groupings of four antennas in each sector at a centerline height of 80 feet. The applicant will also be installing an additional 14 feet by 9 feet 4 inch equipment platform to hold the communication cabinets. The 15 feet by 22 feet lease space is located to the rear of the existing building and is not visible from public right-of- way. A concrete sidewalk and stairs are being extended to provide access to the equipment. The original approval was for up to 75 foot tower and appurtenances. The existing tower is only 68.8 feet tall and has antenna arrays centered on a height of 65 feet. As a condition of approval, the tower was to be able to accommodate additional antennas for co -location. The tower was designed such that it .R Aa / P #a P%WM 3' LOM" woo AWSL , ricroan wnE�x Mf7 /a M. 6 (4) PER %CMF .ou" MMM Mae 101 M6l �� ,u 07naMVLESWR Own fOtA KW 10 -"IL poMER1 r �A awn TO P-.. rW�6 VIP 6 Ai VW" a"- rnow o m —Mpo:AW .� A� Planning Commission 7700 Quattro Drive - Planning Case 2018-03 January 16, 2018 Page 3 of 4 would be extendable in the future to accommodate an additional antenna above the proposed antenna. In addition, the tower was built to accommodate an additional antenna on the proposed tower below the proposed antennas. In essence, at least two additional antennas should be able to be attached to the tower. However, as the request shows, the 75 feet tower height does not accommodate the additional antennas above the existing antennas. Proposed monopole compared to ordinance requirements Ordinance Proposal Tower Height 150 feet/maximum 87 feet Tower Setback 771h Street West 40 feet 185 feet Quattro Dr. 40 feet 280 feet North Property Line 10 feet 125 feet West property line 10 feet 24 feet Existing communication towers in the community range in height from 69 feet to 150 feet in height. Antennas located on the tops of city water towers range from 66 feet to 135 feet. The proposed extension is well within the permitted tower height and is in compliance with City Code. RECOMMENDATION Staff recommends that the Planning Commission approve the amendment to the Conditional Use Permit #2000-6 to permit the construction of an extension of the communication tower up to 90 feet monopole, plans prepared by Design 1, dated revised 04-10-17, subject to the following conditions: A building permit is required to construct the platform and tower extension; the tower must be designed for a 90 MPH wind load and include the effect of one-half inch of radial ice. 2. The original plans must be signed by a professional engineer licensed in the State of Minnesota. 3. The contractor shall meet with the Inspections Division as early as possible to discuss plan review and permit procedures. 4. The applicant shall submit a detailed grading, drainage, and erosion control plan for staff review and approval. Planning Commission 7700 Quattro Drive - Planning Case 2018-03 January 16, 2018 Page 4 of 4 5. The tower extension shall be of the same color as the existing tower. 6. A letter of intent committing the tower owner and his or her successors to allow the shared use of the tower if an addition user agrees in writing to meet reasonable terms and conditions for shared use shall be submitted to the city. ATTACHMENTS 1. Findings of Fact and Recommendation 2. Development Review Application 3. Crown Castle Statement of Compliance 4. Verizon Plan Set Prepared by Design 1 Dated Revised 04-10-17, Sheets T-1, A-1 through A-5, G-1 through G-2, U-1, Preliminary Site Survey 5. Crown Castle Plan Set Sheets S-1 through S-6 6. Public Hearing Notice and Mailing List GAPLAN\2018 Planning CasesA 8-03 - 7700 Quattro Dr staff report 7700 Quattro tower.doc CITY OF CHANHASSEN CARVER AND HENNEPIN COUNTIES, MINNESOTA FINDINGS OF FACT AND RECOMMENDATION IN RE: Application of Crown Castle Services and Marilyn Beddor for an amendment to a Conditional Use Permit for a communication tower extension on property zoned Industrial Office Park. On January 16, 2018, the Chanhassen Planning Commission met at its regularly scheduled meeting to consider the application. The Planning Commission conducted a public hearing on the proposed conditional use permit preceded by published and mailed notice. The Planning Commission makes the following: FINDINGS OF FACT 1. The property is currently zoned Industrial Office Park, IOP. 2. The property is guided in the Chanhassen Comprehensive Plan for Office Industrial uses. 3. The legal description of the property is Lot 1, Block 1, Quattro Addition, Hennepin County, Minnesota. 4. When approving a conditional use pen -nit, the City must determine the capability of a proposed development with existing and proposed uses. The general issuance standards of the conditional use, Section 20-232, include the following 12 items: a. Will not be detrimental to or endanger the public health, safety, comfort, convenience or general welfare of the neighborhood or the city. Finding: The proposed communication tower will not be detrimental to general welfare of the neighborhood. The proposed tower and accompanying equipment building would be compatible with the uses in the industrial park. b. Will be consistent with the objectives of the city's comprehensive plan and this chapter. Finding: The proposed use is consistent with the city's comprehensive plan, ordinance requirements for Highway 5 Corridor District, the IOP district regulations, and the tower ordinance. c. Will be designed, constructed, operated and maintained so to be compatible in appearance with the existing or intended character of the general vicinity and will not change the essential character of that area. Finding: The proposed tower and accompanying equipment building would be compatible with the uses in the industrial park. The location minimizes adverse visual effects of towers through careful design and siting standards which attempt to screen and or camouflage towers from adjacent public and private property. d. Will not be hazardous or disturbing to existing or planned neighboring uses. Finding: The proposed tower will not be hazardous to existing or planned neighboring uses. e. Will be served adequately by essential public facilities and services, including streets, police and fire protection, drainage structures, refuse disposal, water and sewer systems and schools; or will be served adequately by such facilities and services provided by the persons or agencies responsible for the establishment of the proposed use. Finding: The proposed development is provided with adequate public services. f. Will not create excessive requirements for public facilities and services and will not be detrimental to the economic welfare of the community. Finding: The proposed development will not require excessive public services. The proposed tower extension will not be detrimental to the economic welfare of the community. g. Will not involve uses, activities, processes, materials, equipment and conditions of operation that will be detrimental to any persons, property or the general welfare because of excessive production of traffic, noise, smoke, fumes, glare, odors, rodents, or trash. Finding: The proposed tower should not create conditions that are detrimental to persons, property or the general welfare of the community. h. Will have vehicular approaches to the property which do not create traffic congestion or interfere with traffic or surrounding public thoroughfares. Finding: The proposed development will not interfere with traffic circulation. i. Will not result in the destruction, loss or damage of solar access, natural, scenic or historic features of major significance. Finding: The proposed development will not destroy or damage natural, scenic, or historic features. j. Will be aesthetically compatible with the area. Finding: The proposed tower will be aesthetically compatible with the area. It extends an existing communication tower. 2 k. Will not depreciate surrounding property values. Finding: The proposed development should not depreciate surrounding property values. 1. Will meet standards prescribed for certain uses as provided in this article. Finding: The proposed development meets standards established for communication towers. 5. The planning report #2018-03, dated January 16, 2018, prepared by Robert Generous, et al, is incorporated herein. RECOMMENDATION The Planning Commission approves an amendment to the conditional use permit to permit the extension of the communication tower. ADOPTED by the Chanhassen Planning Commission this 16th day of January, 2018. CITY OF CHANHASSEN Chairman g:\plan\2018 planning cases\18-03 - 7700 quattro dr\fmdings of fact quattro.doc 3 COMMUNITY DEVELOPMENT DEPARTMENT OF Planning Division — 7700 Market BoulevardCITY CNESSEN Mailing Address — P.O. Box 147, Chanhassen, MN 55317 Phone: (952) 227-1300 / Fax: (952) 227-1110 APPLICATION FOR DEVELOPMENT REVIEW Submittal Date: 5 PC Date: CC Date: Z / 60-Day Review Date: 2 (Refer to the appropriate Application Checklist for required submittal information that must accompany this application) ❑ Comprehensive Plan Amendment ......................... $600 ❑ Minor MUSA line for failing on -site sewers ..... $100 Conditional Use Permit (CUP) U Single -Family Residence ................................ $325 4kAll Others......................................................... $425 ❑ Interim Use Permit (IUP) ❑ In conjunction with Single -Family Residence.. $325 ❑ All Others......................................................... $425 ❑ Rezoning (REZ) ❑ Planned Unit Development (PUD) .................. $750 ❑ Minor Amendment to existing PUD................. $100 ❑ All Others......................................................... $500 ❑ Sign Plan Review ................................................... $150 ❑ Site Plan Review (SPR) ❑ Administrative.................................................. $100 ❑ CommerciaVlndustrial Districts`......................$500 Plus $10 per 1,000 square feet of building area: (� thousand square feet) Include number of existing employees: 'include number of new employees: ❑ Residential Districts ......................................... $500 Plus $5 per dwelling unit ( units) ❑ Subdivision (SUB) ❑ Create 3 lots or less ........................................ $300 ❑ Create over 3 lots .......................$600 + $15 per lot (_ lots) ❑ Metes & Bounds (2 lots)..................................$300 ❑ Consolidate Lots..............................................$150 ❑ Lot Line Adjustment ......................................... $150 ❑ Final Plat... ....................................................... $700 (Includes $450 escrow for attorney costs)' 'Additional escrow may be required for other applications through the development contract. ❑ Vacation of Easements/Right-of-way (VAC)........ $300 (Additional recording fees may apply) ❑ Variance (VAR) .................................................... $200 ❑ Wetland Alteration Permit (WAP) ❑ Single -Family Residence ............................... $150 ❑ All Others ....................................................... $275 ❑ Zoning Appeal ...................................................... $100 ❑ Zoning Ordinance Amendment (ZOA)................. $500 NOTE: When multiple applications are processed concurrently, the appropriate fee shall be charged for each application. ® Notification Sign (City to install and remove).......................................................................................[................................. $200 rV' Property Owners' List within 500' (City to generate after pre -application meeting) ............... ". �. ............ $3 per address ................. addresses) ❑ . sc ow for Recording Documents (check all that apply) .................................................... .......... $50 per document ,Conditional Use Permit ❑ Interim Use Permit ❑ Site Plan Agreement ❑ Vacation ❑ Variance ❑ Wetland Alteration Permit ❑ Metes & Bounds Subdivision (2 deeds) ❑ Easements ( easements) ❑ Deeds TOTAL FEE: 7 Z3 Section 2: Required Information Description of Proposal: Property Address or Location: 7 7'; ul,%, r I Ov `v Parcel #: (1�� 7.� �`} �i %�L Legal Description: Total Acreage: Wetlands Present? ❑ YesZ"No Present Zoning: _ /Q F Requested Zoning: f —T Present Land Use Designation: Requested Land Use Designation: Existing Use of Property: Check box if separate narrative is attached. w Section 3: Property Owner and Applicant Information APPLICANT OTHER THAN PROPERTY OWNER: In signing this application, I, as applicant, represent to have obtained authorization from the property owner to file this application. I agree to be bound by conditions of approval, subject only to the right to object at the hearings on the application or during the appeal period. If this application has not been signed by the property owner, I have attached separate documentation of full legal capacity to file the application. This application should be processed in my name and I am the party whom the City should contact regarding any matter pertaining to this application. I will keep myself informed of the deadlines for submission of material and the progress of this application. 1 further understand that additional fees may be charged for consulting fees. feasibility studies, etc. with an estimate prior to any authorization to proceed with the study. I certify that the information and exhibits s bmitted are true and correct. (` V Name: Contact: Address: c�C� tJ Hi/� e �f 7S Phone: '7(u'( I AT 2 City/State/Zip: , //i c r► V � Cell: � 2-0 Gmnil• r t, (: _ !1,'L' lGlrli' /,J ��., ) /In7. ' 11, /./i C- f'f.� •• / .y ,��£�..• Signature: 7 -'__ Date: /Z li i PROPERTY OWNER: In signing this application, I, as property owner, have full legal capacity to, and hereby do, authorize the filing of this application. I understand that conditions of approval are binding and agree to be bound by those conditions, subject only to the right to object at the hearings or during the appeal periods. I will keep myself informed of the deadlines for submission of material and the progress of this application. I further understand that additional fees may be charged for consulting fees, feasibility studies, etc. with an estimate prior to any authorization to proceed with the study. I certify that the information and exhibits submitted are true and correct. Name: , I I - Contact: u _ Address: P r Phone:-� ! ��-.ZG�J City/State/Zip: CiL, `' e _ Cell: V� q' - J_� - - _3 %/0 Email: �1\G1`i 1�1\ CACI 1- Fax: This application must be completed in full and be typewritten or clearly printed and must be accompanied by all information and plans required by applicable City Ordinance provisions. Before filing this application, refer to the appropriate Application Checklist and confer with the Planning Department to determine the specific ordinance and applicable procedural requirements. A determination of completeness of the application shall be made within 15 business days of application submittal. A written notice of application deficiencies shall be mailed to the applicant within 15 business days of application. Signature: PROJECT ENGINEER (if applicable) Date: Name: Contact: Address: Phone: City/State/Zip: Cell: Email: Fax: Section 4: Notification Information Who should receive copies of staff reports? *Other Contact Information: ❑ Property Owner Via: ❑ Email ❑ Mailed Paper Copy Name: ❑ Applicant Via: ❑ Email ❑ Mailed Paper Copy Address: ❑ Engineer Via: ❑ Email ❑ Mailed Paper Copy City/State/Zip: ❑ Other* Via: ❑ Email ❑ Mailed Paper Copy Email: INSTRUCTIONS TO APPLICANT: Complete all necessary form fields, then select SAVE FORM to save a copy to your device. PRINT FORM and deliver to city along with required documents and payment. SUBMIT FORM to send a digital copy to the city for processing. CROWN CASTLE Crown Castle 160o Utica Ave S, Suite 475 Saint Louis Park, MN 554i6 763 — 852 -0576 RE: Statement of Compliance for Conditional Use Permit Amendment Application to extend the tower at 770o Quattro Drive. Planning Commission — Per the Conditional Use Permit Application Checklist, there are twelve (12) criteria that must be addressed via a Statement of Compliance. The criteria are addressed below: a. The extension of the tower will not be detrimental or endanger the public health, safeth , comfort, convenience or general welfare of the neighborhood or the city. The tower has existed since 2000, and a condition of the original CUP was to make the tower amendable for an extension for another carrier. This is the exact circumstance found in this application. b. This tosser extension .%ill be consistent with the city's comprehensive plan and this chapter. c. The extension rill be designed, constructed, operated, and maintained so to be compatiable in appearance with the existing or intended character of the general vicinity- and will not change the essential character of the area. The extension %sill match the existing tower and a slight height measurement %sill be the only change. d. The extension will not be hazardous or disturbing to existing or planned neighborhood uses. The tower extension will not change its function; instead more wireless customers sill receive better coverage. e. Will be served adequately by essential public facilities and services, including street, police, and fire protection, drainage structures, refuse disposal, water and sewer systems and schools; or will be served adequately by such facilities and services provided by the persons or agencies responsible for the establishment of the proposed use. There will be no change as to how the facility is maintain and/or its access to services or public facilities. The Foundation for a Wireless World. CrownCastle.com Crown Castle C CROWN � CASTLE 1600 Utica Ave S, Suite 475 Saint Louis Park, MN 55416 763 — 852 -0576 f. The tower extension will not create excessive requirements for public facilities and ser%ices and will not be detrimental to the economic welfare of the community-. Again, there will be no change concerning how the facility is operated. g. The tower extension will not involve uses, actixities, processes, materials, equipment and conditions or operation that will be detrimental to any persons, property or the general welfare because of excessive production of traffic, noise, smoke, fumes, glare, odors, rodents, or trash. h. The tower extension will have vehicular approaches to the properh• which do not create traffic congestion or interfere with traffic or surrounding public thoroughfares. The basic configuration of the compound will not change. i. Tower extensions will not result in the destruction, loos of damage of solar access, natural, scenic or historic features of major significance. Again, the basic features of the site will not change. j. The tower extension will be aesthetically compatible with the area. k. The tower extension will not depreciate property values I. The tower extension meets standards prescribed for certain uses as prodded in this article. Estate Specialist The Foundation for a Wireless World. CrownCastle.com APPROVED Digitally sigr Chad Hiltner By Chad Hiltner at 9:42 am, Apr 11, 2017 ■ veri Chorivtl d DN: cn=Cha O=Crown Ca email=chad. er o Uscastle. Date: 2017. 09:43:27 -05 MIN MACAROON NEW BUILD PROJECT INFORMATION SITE NAME: MIN MACAROON SITE ADDRESS: QUATTRO DRIVE CHANHASSEN. MN 55317 COUNTY: HENNEPIN LATITUDE: N44- 51' 53.46' (NAD83) LONGITUDE: W93' 30' 55.01- (NAD83) DRAWING BASED ON SITE DATA FORM DATED: 08-17-16 BUILDING TYPE: IIB SITE AREA 15' X 22' = 330 S.F ISSUE SUMMARY SHEET OR DETAILISSUED FOR REVIEW 02-14-17 ALL LBREV.DESCRIPTION ISSUED FOR OWNER APPROVAL 04-10-17 ALL SHEETINDEX SHEET SHEET DESCRIPTION T-1 PROJECT INFORMATION, TOWER ELEVATION, 8 SHEET INDEX A-1 SITE PLAN, DETAIL INDEX 8 SITE PHOTO A-2 ENLARGED SITE PLAN AND GRADING PLAN A-3 ANTENNA 8 EQUIPMENT/CABLE KEYS, ONE LINE DIAGRAM 8 DETAILS A-0 j MISCELLANEOUS DETAILS 8 SITE PHOTO A-5 OUTLINE SPECIFICATIONS G-1 GROUNDING SPECIFICATIONS G-2 GROUNDING PLAN 8 GROUNDING DETAIL INDEX U-1 SITE UTILITY PLANS, PULLBOX LOCATION PLAN 8 NOTES SURVEY AREA MAP ROAD DIRECTIONS FROM BLOOMINGTON RNC: HEAD NORTH ON BUSH LAKE RD, THEN TURN LEFT ONTO W 108TH STIW OLD SHAKOPEE RD AND GO 1.0 MILES. TURN RIGHT TO MERGE ONTO US-169 N AND AFTER 3.4 MILES, TAKE THE EXIT ONTO 1-494 W/MN-5 W AND GO 2.1 MILES. TAKE EXIT 11C TO MERGE ONTO MN-5 W/US-212 W AND GO 1,8 MILES. CONTINUE ONTO MN-5 W/W 78TH ST/ARBORETUM BLVD FOR 2.2 MILES. TURN RIGHT ONTO DELL RD AND TURN LEFT ONTO W 77TH ST TURN RIGHT ONTO QUATTRO DR. TAKE FIRST LEFT. SITE WILL BE AT BASE OF EXISTING TOWER BEHIND BUILDINGS. VICINITY MAP NORTH w Qo SITE a W 77th ST CATTAIL CT 0 w CONE - FLOWER LN W 78th ST 5 5 5 5 0 J 0 iltner, DEPARTMENTAL e, oLJ, APPROVALS tner@c ' NAME DATE 1 RF ENGINEER NITHYAKALYANI JAIPURIYAR 03-09-17 OPERATIONS RONALD SIMMONS 02-24-17 MANAGER CONSTRUCTION ALEX HOLZINGER 02-15-17 ENGINEER LESSOR / LICENSOR APPROVAL SIGNATURE PRINTED NAME DATE LESSOR / LICENSOR: PLEASE CHECK THE APPROPRIATE BOX BELOW ❑ NO CHANGES. ❑ CHANGES NEEDED SEE COMMENTS CONTACTS LESSOR / LICENSOR: CCATT LLC (CROWN CASTLE) 1600 UTICA AVENUE SOUTH SUITE MINNEAPOLIS. MN 55416 MEAGAN BENSON (763) 852-0594 LESSEE: VERIZON WIRELESS 10801 BUSH LAKE ROAD BLOOMINGTON, MN 55438 RON REITER (612) 72G-0052 POWER UTILITY XCEL ENERGY COMPANICONTACT: 1518 CHESTNUT AVE MINNEAPOLIS, MN 55403 LINDA MACHEMEHL (952) 470-3321 TELCO UTILITY T B.D COMPANY CONTACT: ARCHITECT. DESIGN 1 OF EDEN PRAIRIE, LLC. 9973 VALLEY VIEW ROAD EDEN PRAIRIE, MN 55344 (952) 903-9299 SURVEYOR: WIDSETH SMITH NOLTING 610 FILLMORE STREET - PO BOX 1028 ALEXANDRIA, MN 56308-1028 320-762.8149 STRUCTURAL CROWN CASTLE, INC. ENGINEER: 2000 CORPORATE DRIVE CONANSBURG. PA 15317 (724)416-9160 GEOTECHNICAL WA ENGINEER: NOTE THESE DRAWINGS DO NOT CONSTTTNE A STRUCTURAL ANALYSIS, BUT WERE PREPARED BASED ON INFORMATION SUPPLIED, AND THEREFORE ARE AS ACCURATE AS THE SUPPLIED DATA THE STRUCTURAL ANALYSIS WAS PERFORMED BY OTHERS AND IS REFERENCED HERE. THESE DRAWINGS CONSIDER THAT THE STRUCTURAL ANALYSIS HAS BEEN PROPERLY PREPARED AND DOCUMENTED. PLEASE COORDINATE ANY STRUCTURAL CONCERNS/MATTERS OR ANY LOADING MODIFICATIONS TO THE CONSULTANT WHO AUTHORED THE ANALYSIS AND NOTIFY DESIGN 1 IMMEDIATELY OF THE ISSUE. TOWER ELEVATION NOTE: 1.) PLATFORM FOUNDATION AND THE ACCESS WALKWAY TO BE EXCAVATED AND CONSTRUCTED IN ACCORDANCE WITH RECOMMENDATIONS AND SPECIFICATIONS OF THE GEOTECHNICAL REPORT WHICH IS NOT INCLUDED IN THIS PACKAGE. DISCREPANCIES BETWEEN THE REPORT AND THE OTHER DOCUMENTS TO BE IMMEDIATELY REPORTED TO VERIZON WIRELESS AND THE ARCHITECT. 2.) CONTRACTOR TO ENSURE TIP OF ANTENNAS DO NOT EXCEED TOWER HEIGHT. PROPOSED ANTENNAS, PLATFORM k FEEDUNES TO BE INSTALLED IN ACCORDANCE W/ TOWER STUDY DATED 12-09-16 BY CROWN CASTLE. PROJECT/ 1294289 AND SMALL ADO LETTER DATED 03-31-17 BY CROWN CASTLE APP D: t359616 REV: 8 OIL OVERALL SIRUCRIRE HEIGHT 1019.0' AMSL / 87.0' AGL WOW TIP/FUTURE ak TOWER HEIGHT 1016.0' AMSL / 84.0' AGL ANTENNA H H 80.0' AGL DOSTIrG TOWER HEIGHT Y 1 DOO.8' AMSL / 68.8' AGL EXISTING PRONDER 997.0' AMSL / 65.0' AGL PROPOSED 3' LIGHTNING ROD (12) PROPOSED ANTENNAS, TYP. OF (4) PER SECTOR PROPOSED 152' DaDGON BY LESSOR PROPOSED CABLES TO RUN UP EXTERIOR OF TOWER, SEE A-4 EXISTING 68.8' MONOPOLE TOWER: PROPOSED CABLE BRIDGE, SEE A-4 PROPOSED EQUIPMENT PLATFORM EXISTING EQUIPMENT PLATFORM �Is I�., GRADE 0 4 � . Sm We■ 0m 932.0' AMSL FENCE, WkL AND STAIRS NOT SHOWN FOR CLARITY %1 EAST ELEVATION l SCALE: 1' = 20' 0 1 m off:- •..r�, LICENSED ARCHITECT _ 12427 :Q ,Ile I hereby certify that this plan. spedficalgn or repal was Prepared by me or under my dived supety- and that I am a duly registered Architect under the laws of the State of Mmnesola R08ERTJ DAVIS, Reg. No 12a2 Date DESIGN L 9973 VALLEY VIEW RD. EDEN PRAIRIE, MN 55344 (952) 903-9299 W W W.DESIGNI EPCOM verizonv' 10801 BUSH LAKE ROAD BLOOMINGTON, MN 55438 1612) 720-0052 PROJECT I 20130877426 LOC. CODE: 265810 MIN MACAROON CC BU #878498 QUATTRO DRIVE CHANHASSEN, MN 55317 SHEET CONTENTS: CONTACTS ISSUE SUMMARY SHEETINDEX DEPARTMENTAL APPROVALS LESSOR APPROVAL PROJECT INFORMATION AREA 8 VICINITY MAPS GENERAL NOTES DRAWN BY: DJS DATE: 06-31-16 CHECKED BY: BMS REV. A 02-14-17 REV B 04-10-17 T-1 CROWN --ASTLE LEASE AREA CROWN CASTLE UTILITY EASEMENT I EXISTING UTILITY e I I I 700STIN(l AWN CASTLE 20' UTILITY, TYP AND ACCESS EASEMENT - =OWN CASTLE 10' F - - - '- I UTILITY AND I - - .-CESS EASEMENT\ i _ r7 = `EXISTING 1 BUILDING 1 22' LAND SPACE i 1 4. 477 / LEXISTING BUILDING EXISTING UNDERGROUND 1 ; FIBER, TYP, 1 1 EXISTING 1 UNDERGROUND i ELECTRIC, TYR 4 •I - —GAS—GAS GAS —GA' -- — CA - L- - - - - - 1 \ \ 1 1 1 II; 1 1 III 11,11 r \ EXISTING BITUMINOUS 1 PARKING LOT I II EXISTING TURF, TYP I I CROWN CASTLE 20' UTILITY I ` AND ACCESS EASEMENT GENERATOR TYPE: N/A - CAM-LOK FROST DEPTH DESIGN = 4'-0" GAS -- G- uAS DETAIL INDEX DETAIL DETAIL DESCRIPTION PLATFORM VZW9 4X14-GLSP-4. 9'-4'x14'-0" PLATFORM W: FULL C-' _ _ 2 1 FENCE SECTION (DETAIL 2) 31 CABLE BRIDGE SECTION 44 CABLE BRIDGE ELEVATION (SIMILAR) 61 GATE DETAIL (DETAIL 1 SIMILARI 71 ;PS MOUNTING DETAIL (DETAIL 1) 81 -0 ENTRY DETAIL 91 CMPH DETAIL 107 -)NE-LINE ELECTRICAL RISER DIAGRAM (G.C. TO VERIFY 12 ' METER PEDESTAL (DETAIL 2'1 C ICE SHIELD 1 r I � I Lu I x 1 i ( I \ EXISTING UNDERGROUND 31% TELCO, TYP.EXISTING UNDERGROUNDELECTRIC, TYP.II oil W U., I � I I I \ I IJ o _ EXISTING ' 1 BITUMINOUS 4 I DRIVE WAY I L- - - - - - - - I lu-A- I I W - - - - _ _ _ I VJ Q I EXISTING UNDERGROUND GAS 111E. TYP. 1 u I I EXISTING PUBLIC RIGHT OF WAY, TYP. I \ uc-E i LLJ I Q I Q .I,, --- - --- ----------- ,11 r -ITT.--- - UGT_ ll �Tr ----� __ _7 CROWN CASTLE 10' OC - FOC FT)G — - - - - - +Jkd -;. - FOC - UTILITY EASEMENT ` - - - F )W - _ - - _ -- _--------------- - SITE PLAN GRWHIC SCkf - - - - %// o I 1 5 3 \�\_96 J' Dq/�' LICENSED ARCHITECT 12427 ` DESIGN K 9973 VALLEY VIEW RD, I =DEN PRAIRIE, MN 55344 1903-9299 N DESIGNIEP.COM verizonv/ 10801 BUSH LAKE ROAD BLOOMINGTON. MN 55438 y 12,'20-00,52 I PROJECT 20130877426 LOC. CODE: 265810 MIN MACAROON CC BU #878498 QUATTRO DRIVE CHANHASSEN. MN 55317 SHEET CONTENTS SITE PLAN DETAIL INDEX REV A REV B NORTH (1) A-1 Dj_� I I � I I _ -J VERSA-LDK RETAMIG — — — — WAUL TYP. APPROX 46 I -0 L V- 610E Oa 4!-VIt I 10'-C SEE A-4GATE FENCE w6w 930.20' r T Q92750 W-00' x :11-_ c x - - TREE LOE j 9'-4' - 9'-4" _ _ 2'-C LC ICE SI#UD, ------ x SEE DETAL IDE)(I ORIGINAL EXISTING TREE LINE, TYP. I I T.O. EXISTING TREES. TYP;� in PLATFORM At 932.50' I 9J0 50' I AMSL % I I I CLEAN a O i x G C TO RT]IOVE El- ROCK OVER PLATFORM STAR --- GEOTEXTI.E I NO TiUM CL610M I TO MATCH 929 HMaUAI 014F. BOK 'r I L EXISTING x WCM --�! ! 930 d LjLj RELOCATION OF EXLSTIryNyG� LESSOR DI ESSOR 4'-0a I I MIN. CLEAR x DIST. BOX SIM. TOEXISTING 1 GRASS, TYP. I I x ILC ICE SHIELD I x - EXISTING CHAIN LINK I.E. EISEXISTING CROWN CASTLE I PLA x IIL UTILITY EASEMENT 931_M - 930 x CROWN CASTLE LEASE AREA EXISTING CABLE EXISTING CLEAN ; x ROCK, TYP. BRIDGE x 1 I - EXISTING H-FRAME -i--. _ \ ` x 1 L BRIM x -, + x EXISTING MONOPOLE TOWER, SEE T-1 I EXISTING TIMBER RETAINING WALL TYP. I I k C10NIO16l5, 930 ---- I EXISTING GATES, TYP. j I 6'-7• I r FENCE EXISTING CONCRETE SIDEWALK, TYR. CONCRETE STARS, SEE A-4 CONCRETE SIDEWALK, TYP. SEE A-4 CUSTOM ILC BOX LOCATION LESSEE LAND SPACE REMOVAL OF EXISTING SIDE WALK, BY CONTRACTOR VERSA-LOK RETAINING WALL, TYP. APPROX 62 L.F. SEE A-4 EXISTING J BUILDING RELOCATION 6r LF. OF EXISTING FENCE, BY CONTRACTOR REMOVAL OF EXISTING TUBER WALL, APPROX 53 LF. BY CONTRACTOR c� EXISTING METER — ?' CROWN CASTLE l - EXISTING UTILITY EASEMENT CONCRETE ( I SURFACE, ..t. TYR NORTH ENLARGED SITE PLAN " E SCALE: 1/8' = 1'-0' 0 4' NOTE -- CONTRACTOR TO COORDINATE PUBLIC AND PRNATE UTIUTY LOCATES PRIOR TO CONSTRUCTION START. NOTIFY THE ARCHITECT AND THE VZW CONSTRUCTION ENGINEER IMMEDIATELY OF ANY UTUTY LK ISSUES. NOTE EQUIP" PLATFORM PROVIDED ASSEMBLED WITH GUARD RAILS, ILC (INTEGRATED LOAD CENTER), CANOPY AND LIGKr FIXTURE CONTRACTOR TO PROVDE ADEQUATE LIFTING EQUIPMENT FOR POW AND SETTING ON FOUNDATION. TOWER EXTENSION SITE PHOTO 2 SCALE:NONE LICENSED ARCHITECT _ 12427 I hereby cariM that ns plan specification or repod was prepared by me or urWer " r, - supenhsbn and that I am a 0 ,1, regatered Archked under the laws of the State of M-ota ROBERTJ DAVIS. Reg No 12427 Date DESIGN 9973 VALLEY VIEW RD. EDEN PRAIRIE. MN 5S344 3-9299 (952)90 W W W.DESIGN 1 EP.COM verizon\l 10901 BUSH LAKE ROAD BL00MM1GTON, MN 55438 (612)720-0052 PROJECT 20130877426 LOC. CODE: 265810 MIN MACAROON CC BU #878498 QUATTRO DRIVE CHANHASSEN, MN 55317 SHEET CONTENTS ENLARGED SITE PLAN SITE PHOTOS DRAWN DATE SITE PHOTO CHECKL 3 SCALE: N0NE REV' a A-2 NOTE: T-FRAME & COLLAR MOUNT TO BE SITE PRO 1 #RMOP-496-HK MOUNT (12) 2.5'0 x 8.5' LONG SCHEDULE GALVANI7FD 40 UOII"Nr PIPES X SEGTOR POSITIONS, FRAME 350 #3 #2 Ci (4) RRUS, TYP. 3 SECTORS #4 0 ANTENNA MOUNTING DETAIL NORTH SCALE: 3/16" = 1'_0 GRAPHC SCALE 0 4'—0" T-4" 0 x - GPS MOM — NOTE X O CABLE BRIDGE SUPPORTS ARE REOUitED AT INTERVALS NOT TO EXCEED 6'-0' MRTH x OVERFIANG EXTENSX)NS NOT TO EXCEED 1'-6' NOTE 'ol o_ CONTRACTOR TO ENSURE CABLES DO NOT j 1 m ENTER THE FRONT OF CABINET TOP HAT TO X ACCOWODATE VZW OPERATIONS TENT �' DEF AVANT, COORDINATE WITH VZW CE x 1'-2' 1 x m 1'-6' EXISTING eLV-C CABLE BRIDGE X x 3-2• _ •.5/ C� SPLICE x + I-T BRACKET O_2CABLE BRIDGE PLAN SCALE: 1" = 10'-0" GRAPtIC SCALE NORTH EXISTING CABLES (INTERIOR) EXISTING CABLE PORT EXISTING SAFETY CUMB, ABOVE r 3' SAND s' CONCRETE W/ s (6 GRADE w.W.Y 3 CONCRETE SIDE WALK SCALE: 1/2' = 1'-0' 01ypy� yxE 2' PROPOSED RRU TRUNK CABLES OUTSIDE THE MONOPOLE TO THE 0 4'-0' O.C. USING THE FOLLOWING: 1) PROPOSED CABLE HANGER, COMMSCOPE SNAPSUK IWIGER AND GROMMET KIT jSSH-38 2) TOWER STANDOFF BRACKET, SITE PRO 1 W 3) STAINLESS BANDING. SITE PRO 1 W06 4) STAINLESS BANDING BUCKLES, SITE PRO 1 IBU256-25 PROVIDE QUANTITIES AND ALL MISCELLANEOUS MOUNTING HARDWARE AS NECESSARY FOR INDICATED FASTENER SPACING. NORTH CABLE DETAIL SCALE 5 SCALE: 1i2" = 1'-0" o r z' FENCE. BEYOND77 rn 5 TREADS AT VERSA-LOK RETAINING WALL, - `� I I I COMPACTED FILL BEYOND - y CONCRETE SLAB TYP. o (4) j4 AMOCO 4545 -44 VERTICAL 1 I GEOTEXTILE I_ REBAR IN I 1 1 BASE SAND. Y I I PIER. TYP. - 1 1 DRAINAGE AGGREGATE -L- _ - _ j - 1 12 INCH THICK MIN.PIER 1 -- FDUIMiION - - ( - 4 INCH 0 DRAIN PIPE, NOT S M FOR - ( � _ If CONCRETE PERL—� LOOP AROUND CONCRETE( - L_ _ -- - E PIERS FOR 14 REBAR AT 1C -- TYRCLARITY - T HANDRAIL - 1 1 ON CENTER 24 24 r AT CORNERS - - UNDISTURBED SOIL _ - - /4 STiiRUP AT 16' O.C. COMPACTED 3/4 ' -- --- - `_ MINUS GRAVEL �-- � µ REBAR �1°' 3Y OC W/ 1' SAND LEVELING COURSE _ 6 INCH THICK MIN. X 2(Y CONCRETE FOOTW GALVANIZED HMgRMI, TV. HEIGHT OF WALL T.B.D. IN FIELD VERSA-LOK MODULAR CONCRETE UNITS, MODEL: STANDARD WEATHERED COLOR: GRAY CAP UNIT ADHERED ' TO TOP UNIT W/ VERSA-LOK CONCRETE ADHESIVE W EXISTING GRADE LICENSED ARCHITECT 12427 el I hereby candy that bW plan, specification or report was .mpared by me or under my d.W supervrson and that I am a duly reglsfeted Architect under !ne laws of the State of Mwwwmu ?OBERT J DAVIS Reg No 12427 �"1, �M `. DESIGNfi, 9973 VALLEY VIEW RD. I EDEN PRAIRIE, MN 55344 (952) 903-9299 %V"W DESIGNI EP COM venzonv' 10801 BUSH LAKE ROAD BLOOMINGTON, MN 55438 (612)720-0052 PROJECT 20130877426 LOC. CODE: 265810 MIN MACAROON CC BU #878498 QUATTRO DRIVE CHANHASSEN, MN 55317 SHEET CONTENTS: ANTENNA MOUNTING DETAIL CABLE BRIDGE PLAN STAIRIWALL SECTION CONCRETE SIDE WALK DRAWN BY: DJS DATE: 08-31-16 CHECKED BY: BMS 1 REV- B 04-10-171 STAIRMALL SECTION GRAPW SCALE 4 SCALE: 3/8' = 1'-0" 10 1 1'14• z•-s' A 4 00 0001 PERMITS Construction Permit shall be acquired by, or in the name of, Verizon Wireless, to be hereinafter referred to as the OWNER. Other permits shall be acquired by the Contractor. 00 0002 SURVEY FEES Survey shall be furnished by the Architect. Layout Staking shall be coordinated with the Surveyor per 'Request For Quote', (RFQ). 01 0010 INSURANCE & BONDS Contractor is to furnish Insurance certificates for themselves and subcontractors. Contractor will provide any required Bonding. Contractor agrees to warranty the project for (1) one year after completion. 01 0400 SUPERVISION & COORDINATION Contractor shall provide supervision throughout the Project, coordinating the work of the Subcontractors, and delivery & installation of Owner—fumished items. Contractor's responsibilities include arranging & conducting of Underground Utilities Locates. Contractor shall comply with municipal, county, state and/or federal codes including OSHA 01 0600 TESTING Contractor is responsible for providing Agencies with sufficient notice to arrange for Test Samples (I.e.: Concrete Cylinders), and for Special Inspections 01 2000 MEETINGS Contractor shall make themselves aware of, and attend, meetings with the Owner and/or Architect. Contractor is to attend a Pre —Construction Meeting of all parties involved, prior to the start of construction. 01 5100 TEMPORARY UTILITIES Contractor shall maintain the job site in a clean and orderly fashion, providing temporary sanitary facilities, waste disposal, and security (fence area or trailer module) 01 5300 EQUIPMENT RENTAL Contractor shall furnish equipment necessary to expedite work. 01 5900 FIELD OFFICES & SHEDS Contractor shall provide security (fence area or trailer module) for tools and materials that remain overnight on site. 01 7000 CLEAN UP & CLOSE OUT Contractor shall clean up the Site to the satisfaction of Owner. Contractor shall complete the items listed on the Owners Punch List, and stall sign and return the List to the Owner. Contractor shall maintain a set of drawings during the job, on which changes shall be noted in red ink. A full set of redlined drawings (As—Buitts) are to be given to the Architect at Job completion and submit 'construction work complete memo' to Construction Engineer. 01 8000 TRUCKS & MILEAGE Contractor shall provide transportation for their own personnel. 01 8300 TRAVEL TIME & PER DIEM Contractor shall provide room and board for their own personnel, and reasonable time for traveling to & from job site. 01 9200 TAXES Contractor shall pay sales and/or use tax on materials and taxable services. a ITINIM 02 1000 SITE PREPARATION Contractor is to mobilize within 7 calendar days of the Owner issuing a 'START' document. Contractor will immediately report to Architect if any environmental considerations arise. Site shall be scraped to a depth of 3' minimum to remove vegetative matter, and scrapings shall be stockpiled on site. Excess material to be disposed of in accordance with RFO. A Perimeter Silt Fence is to be maintained for the duration of the work Contractor to remove trees and existing conditions as indicated on drawings. Trees to be removed include trunk, branches, leaves, stumps, roots, and vegetative matter NI wood, debris, and vegetative matter is to be completely disposed of and stump voids are to be backfilled and compacted with adequate soils. 02 1100 ROAD IMPROVEMENT & CONSTRUCTION N/A 02 20M EARTHWORK & EXCAVATION Excavation material shall be used for surface grading as necessary, excess to be stockpiled on site. Excess material to be disposed of in accordance with RFQ. For dewalenng excavated areas, contractor shall utilize sock or sediment fitter for filtering of water discharge. 02 5000 PAVING & SURFACING Concrete paving shall be 5' thick, reinforced with 6'x6' welded wire mesh or M3 steel bars 18' o.c.e.w., over a 3' sand cushion. Contractor shall insure that existing concrete parking area is protected against damage during this work, and any damage that may occur shall be repaired or replaced to equal existing preconstruction condition. 02 7800 POWER TO SITE Contractor shall coordinate the electrical service to the platform with the Utility Provider. Conduits shall include pull strings. Underground conduits shall be 2-1/2' Schedule 40 M. (schedule 80 PVC under roads and drives) Cable to be 3/0 THWN CU. Trenches shall be bockfilled in a timely fashion, using a compactor, and including two (2) detectable ribbons; one each at 3' and 15' above conduit, Service shall be 200 amp, single phase, 120/240 volt. Service type shall be 'General Time —Of —Day if available, and meter base shall be approved by utility provider. 02 7900 TELCO TO SITE Contractor shall provide 2' schedule 40 PVC conduit, (schedule 80 PVC under roads and drives) with 'large sweep' elbows or 2" SDR-11 HDPE conduit for directional boring, & pull string for TELCO service as noted on plans. Cable to be fiber optic lines, source and provider T.B.D. Trenches shall be as in 02 7800. 02 8000 SITE IMPROVEMENTS Areas bounded by fence and adjacent to Equipment Platform shall receive polyethylene geotextile, 200 mesh woven, topped with 3' deep 3/4' to 1 1/2' clean rock (no fines), raked smooth. Clean rock shall match existing. 02 8001 FENCING All fence materials and fittings shall be galvanized steel. Fence shall be 6'-0' high x 9 go. X 2' chain link fabric, w/ 7 ga. bottom tension wire. Comer and Gate posts shall be 2 7/8' O.D. sch 40 steel pipe, driven 60' below grade. Line posts shall be 2 3/8' O.D. sch 40 steel pipe. Top Rails shall be 1 5/8' O.D. steel pipe. Gate frames shall be 1 5/8' O.D. welded pipe. Fence top shall be three (3) strands barbed wire to T—O' above grade, canted outward. Bracing shall be 3/8' truss rods and 1 5/8' O.D. pipe mid —rails at comers. Gate latch shall be commercial grade, 'Cargo' or equal. Fabric shall extend to within 1' of finish grade. Existing fences shall be protected against damage during this work, and any damage that may occur shall be repaired or replaced to equal existing pre —construction condition 02 85M IRRIGATION SYSTEMS N/A 02 9000 LANDSCAPING Contractor to restore turf areas damaged by construction by preparing soil, placing sod & watering to maintain grass survival for 1 year. Contractor shall protect existing landscape elements that are not in the Scope of Work_ Reasonable precautions shall be taken to assure the health of existing trees and shrubbery. If conflicts arise regarding the location of root systems, branch lines, etc., the Architect must be contacted prior to performing Work that may cause damage. Damage resulting from disregard of this Article shall be compensated by the Responsible Party and at a cost to be determined by the Property Owner, Architect, and Owner. CONCRETE 03 1000 CONCRETE FORMWORK Concrete forms shall be dimension lumber, modular, or steel. 03 3100 STRUCTURAL CONCRETE Concrete shall be 6% t1% air entrained, and 4,000 psi at 28 days. All reinforcing steel is to be Grade 60 (ASTM 615). Concrete forms shall be dimension lumber, modular, or steel, 03 6000 GROUT N/A 03 8000 TOWER FOUNDATION N/A 03 8001 CATHODIC PROTECTION N/A 03 9000 EQUIPMENT PLATFORM FOUNDATION Contractor shall furnish & install materials for Equipment Platform foundation. Concrete shall be 6% 31% air entrained, and 4,000 psi at 28 days. All reinforcing steel is to be Grade 60 (ASTM 615). Anchor bolts are furnished by Contractor. Contractor shall comply with the Owner's Standard CONSTRUCTION SPECIFICATIONS MINIMUM CONCRETE STANDARDS. MASONRY Contractor shall furnish & and install C.M_U wall assembly per Architectural Documents. Block shall be 7-5/8' x 11-5/B' x 15-5/8'. Mortar shall be Type N and comply with ASTM C 270, joints concaved. 05 0000 METALS Contractor will furnish and install structural and fabricated steel items not specifically furnished by Owner, and install Owner —furnished items Structural steel shall be fabricated and erected per AISC specifications. Welding shall conform to AWS standards. Field welding shall be as shown on Shop Drawings, performed by AWS Certified Welders, and inspected as prescribed by the Structural Engineer. Steel shall be ASTM A992 OR A36, and 3/4' field bolts shall be A325. Temporary erecting bolts, clip hangers, and bracing shall be furnished by Contractor. Fabrications shall be shop welded if possible, and galvanized before delivery to site. Structural steel, and miscellaneous iron and steel, shall be hot dipped galvanized per ASTM A123 thickness grade 55. Fabricated iron and steel hardware shall be hot dipped galvanized per ASTM A153. Repair of damaged or uncoated galvanized surfaces shall be per ASTM A780. WOOD & PLASTICS N THERMAL & MOISTURE DOORS AND HARDWARE N/A FINISHES N/A SPECIAL CONSTRl1C M 13 1260 CABLE BRIDGE, CANOPY, & ICE SHIELDS Contractor shall furnish & install materials for the Cable Bridge as indicated on the drawings and Verizon Wireless Standard Details. Pkatforrn canopies are supplied by Equipment Platform Manufacturer. Contractor shall install canopy components shipped loose with the Equipment Platform. Contractor shall fumish & install materials for the lee Shields as indicated on the Drawings & Verizon Wireless Standard Details, 13 1400 ANTENNA INSTALL Contractor shall install Owner's antennas and feed lines during erecting. Contractor shall test and certify feed lines per current VZW standards. 13 3423 TRANSPORT AND SET EQUIPMENT PLATFORM Contractor shall provide crane(s) and/or truck for transporting, setting and erecting Equipment Platform per RFQ. Contractor shall install items shipped loose with the Equipment Platform including, but not limited to, the following: anchoring plates; exterior lighting; canopies; guardrails; and buss bar. 13 3613 TRANSPORT AND ERECT TOWER EXTENSION Contractor shall schedule delivery of the tower extension and provide cranes for unloading and erecting. Contractor shall ensure the existence of a 3/8' cable safety cimb (DBI/Sala or equal) on the Tower. MECHANICAL 15 4000 PLUMBING N/A 15 5000 HVAC N/A ELECTRIC 16 5000 LIGHTING AND ELECTRICAL Contractor shall provide labor and materials as necessary to complete the work shown on Drawings including items shipped loose with the Equipment Platform assembly. 16 6000 GROUNDING Contractor shall make themselves familiar with and follow the current GROUNDING STANDARDS of VERIZON WIRELESS. Contractor shall perform work as shown on Grounding Plans. Any site —specific grounding issues not covered by the GROUNDING STANDARD are to be addressed by the Contractor to the Owner. OWNER —FURNISHED EQUIPMENT k FEES EQUIPMENT PLATFORM TOWER EXTENSION CABINETS COAX AND/OR CABLES ANTENNAS & DOWNTILT BRACKETS GPS & CAM —LOX BUILDING PERMIT FEES MATERIALS TESTING FEES SPECIAL INSPECTIONS FEES RF BARRIERS & SIGNAGE CONTRACTOR—FURNNSHED EOUPIF]iT POWER TO SITE TELCO TO SITE CABLE BRIDGE GPS MOUNTING GROUNDING MATERIALS FENCING AND ICE SHIELDS CONNECTORS, BOOTS, & RELATED HARDWARE CONCRETE PAVING CONCRETE STAIRS AND RAIUNG VERSA—LOK RETAINING WALL ANTENNA PLATFORM CONTRACTOR SHALL PROVIDE MATERIALS, LABOR, TOOLS, TRANSPORTATION, SUPERVISION, ETC. TO FULLY EXECUTE WORK. WORK REQUIREMENTS ARE DETAILED ON THE DRAWINGS AND SPECIFICATIONS AND SHALL INCLUDE, BUT NOT BE LIMITED TO, THE FOLLOWING ITEMS: SITE PREPARATION SITE WORK EQUIPMENT PLATFORM FOUNDATION SET PLATFORM ROUTING OF GROUND, POWER, FIBER & ALARM SITE GROUNDING ELECTRICAL & TELEPHONE SERVICES INSTALL ANTENNA PLATFORM INSTALL ANTENNAS & CABLES CABLE BRIDGE AND ICE SHIELDS GRAVEL SURFACING & FENCING CONCRETE PAVING CONCRETE STAIRS AND RAILING VERSA—LOK RETAINING WALL Contractor to compare drawings against Owner's 'Request for Quote', (RFQ) If discrepancies arise, Contractor shall verify with Owner that the RFQ supersedes the drawings. O��R�.. -��.DA LfJ•;; LICENSED ARCHITECT 12427 Q I hereby cerbty that this plan. speorficatan or report was prepared by me or under my drat! supervrsror. and that am a duly ,egistered Architect urger t'le IaWs of the state do Mr—sata ROBERT J DA: IS, Reg No 1242- DESIGN 6 9973 VALLEY VIEW RD. EDEN PRAIRIE MN 553" 19521903-9299 :I VW'.DESIGN1EP.CCr' IF verizonillil 1 D801 BUSH LAKE ROAD BLOOMINGTON. MN 55438 1612) 720-0052 I PROJECT I 20130877426 LOC. CODE: 265810 MIN MACAROON CC BU #878498 QUATTRO DRIVE CHANHASSEN, MN 55317 SHEET CONTENTS: OUTLINE SPECIFICATIONS A-5 GENERAL GROUNDING NOTES: An external buried ground ring (Lead 1) shall be established around the equipment shelter and tower foundations. Lead 1 shall be kept 24" from foundations; if foundations are less than 48" apart, keep Lead 1 centered between them. If the tower base is over 20'-0' from the equipment shelter, a separate Lead 1 shall be established around each foundation, and the two Lead is shall be bonded with two parallel leads at least 6 feet apart horizontally. Connections between the two Lead 1s shall be bi-directional. All subgrade connections shall be by exothermic weld, brazed weld, or gos-tight UL467-listed compression fittings pre -filled with anti -oxidant compound. Subgrade connections shall n_QJ be 'cold galvanize' coated. Lead 1 shall be 12 solid bare tin -clad (SBTC) copper wire buried at local frost depth Lead 1 bends shall be minimum 24" radius. 'Whip' lead bends may be of 12" radius. Ground rods shall be galvanized steel, 5/8'0, spaced ten feet apart, or as shown. Rods shall be kept min. 24 inches from foundations. Ground rods are required to be installed at their full specified length. Depth shall be as shown in Detail Booklet. SPECIAL CONSIDERATIONS FOR GROUND RODS When ground rods are not specified to be backfilled w/ Bentonite Slurry: If boulders, bedrock, or other obstructions prevent driving of ground rods, the Contractor will need to have drilling equipment bore a hole for ground rod placement. Hole to be backfilled w/ Bentonite Slurry. When specified with slurried Bentonite encasement, drilling equipment will be need to be used to be bore a hole for ground rod placement. Slurry sholl be made from pelletized material ('Grounding Gravel'); powdered Bentonite is not allowed. If boulders, bedrock, or other obstructions are found, Contractor shall drill to the specified depth and provide Bentonite encasements. Above -grade connections shall be by lugs w/ two -hole tongues unless noted otherwise, joined to solid leads by welding (T&B 54856BE "BROWN'), self -threading (RECOGNIZED. EM 2522DH.75.312), or 10,000psi crimping (BURNDY YA3C 2TC 14E2). Surfaces that are galvanized or coated shall have cooting(s) removed prior to bolting. Bolts shall be stainless steel with flat washers on each side of the connection and a lock washer beneath the fastening nut. Star -tooth washers shall be used between lug & dissimilar metal (copper -to -steel, etc) but are not required between tin -clad CU lugs & tin -clad CU bus bars. Lug tongues shall be coated with anti -oxidant compound, and excess compound wiped clean after bolting. The connection shall then be coated with cold -galvanizing compound, or with color -matching paint. Ground bars exposed to weather shall be tin -clad copper, and shall be clean of any oxidation prior to lug bolting. Galvanized items shall have zinc removed within I' of weld area, and below lug surface contact area. After welding or bolting, the joint shall be coated with cold galvanizing compound. Ground Bar leads Ground bars are isolated electrically from tower bottoms and equipment shelters by their standoff mounts. Leads from each ground bar to the ground ring shall be a pair of #2 SBTC, each connected to Lead 1 bi-directionally with 12 SBTC 'jumpers'. Pairs of #2 SBTC may be required between ground bars. Leads shall be routed to ground bars as follows: • The Main Ground Bar (MGB), typically mounted inside on the equipment shelter 'bock' wall. • The Entry Cable Port Ground Bars (ECPGB), mounted inside and outside on the equipment shelter walls beneath the transmission line port. Note: Transmission line grounds also attach to the ECPGBs. • The Transmission Line Ground Bar (TGB) mounted at the base of the tower to which the transmission line grounds are attached. Transmission line grounds also attach to the TGBs. NOTE: Contractor shall confirm that TGBs exist at 75-foot vertical intervals on any guyed or self-support tower, and that transmission lines are grounded to each TGB. Only the bottom -most TGB is isolated from the tower steel frame; upper TGBs may use the tower steel frame as common ground, requiring no copper leads between TGBs. 2 SBTC Whip lead "Whip" leads shall connect the buried external ground ring to the following items: Monopole Towers: • Three whips to flanges on the monopole base, at least 90' apart. If none are provided, attach to the boseplate or consult tower manufacturer. Self -Support Towers: • Two whips to flonge(s) on each tower leg base. If none are provided, attach to the baseplate or consult tower manufacturer. Guyed Towers: • Two whips to flonge(s) on the tower base. If none are provided, attach to the baseplate or consult tower manufacturer. • Establish a Lead 1 within the fence enclosure of each guy anchor, at least 40 foot perimeter and having 4 ground rods. • #2 SBTC leads shall extend up, and be clamped (bronze clomshell or equal), to any two guy wires. NEVER weld leads to the guy wires. The lead to the guy anchor 'hand' plate may be welded. Fences: Metallic fence within 25 feet of tower Lead 1, or within 6 feet of shelter lead 1, shall have whip leads as follows: • Each comer post. • Each pair of gate posts. • Any line post over 20'-0" from a grounded post. • Each gate leaf to its respective gatepost using braided strap (3/4", tin -clad copper w/ lug ends). • Fences around guy anchors shall be grounded in similar fashion. Fuel tanks: NEVER WELD to any fuel enclosure. NEVER penetrate the fuel containment. Metal tanks shall have one whip lead attached. Use an approved clamp or two -hole lug on an available flange. Equipment Shelter and Other General Requirements • Extend new Lead 218 up to shelter halo, remaking two-way connections as needed. Generator -equipped shelters have 6 such connections. Connections within the shelter shall be by compression; NEVER weld inside the shelter. • Each vertical support pipe of the exterior cable bridge. Bridge end shall be kept at least 6' from the tower structure. The cable bridge shall be jumpered to the vertical support pipes with #2 SBTC at each vertical support pipe. • Opposite comers of the roof shield over the equipment shelter. • Each HVAC unit shield, if separate (may be jumpered' to main roof shield). • Each HVAC package unit. • Commercial electric meter box. • Generator receptacle, if present. • Steel building skid, if shelter is metal frame. • Each air intake or exhaust fan vent louver. • Each generator vent hood or louver. • Generator exhaust stack, external. • Opposite comers of generator support frame, if separate from shelter. • Generator fuel tank, if separate from generator unit. • Host building rain gutter, downspouts, and roof fleshings within 25 feet. • Telco MPOP (Main Point of Presence), if external to equipment shelter. • Within cable vaults, one each to the ladder and to the manhole rim. Note: The door frame is connected to the interior ground halo, and need no separate connection to the external ground ring. Inspection & Testing Test lead #1 and ground rods after installation but before backfilling or connecting to any other grounding, using the 3-point fall of potential method. Contractor to notify Verizon Wireless senior construction engineer at least 48 hours prior to testing. Document installation and test results with photographs. SYMBOL AND NOTE LEGEND ---- /2 SBTC AROUND SHELTER, TOWER, OR GUY ANCHOR 5/8- X 10'-0' GALVANIZED STEEL GROUND ROD OTEST WELL PREFERRED LOCATION 12 SBTC 'WHIP' LEAD �_ (2) 12 SBTC FROM MGB, PGB, OR TGB TO LEAD 1 © AC HVAC UNIT 21 B BC BUILDING CORNER © BO BOLLARD © CBS CABLE BRIDGE SUPPORT POST ® EL ELECTRICAL SERVICE GROUND © EM COMMERCIAL ELECTRICAL METER © FAN GUY ANCHOR PLATE © FP FENCE POST ® GEN GENERATOR GP GATE POST, 3/4' BRAID STRAP TO LEAF © GPS GPS UNIT © GUY GUY WIRE, MECH. CLAMP ONLY - NO WELDS © HL HOOD OR LOUVER © HB OUTSIDE OF HOFFMAN BOX © ILC INTEGRATED LOAD CENTER ( MGB MAIN GROUND BAR © MU GENERATOR MUFFLER Q PGB PORT GROUND BAR © RBR FOUNDATION REINFORCING © RS ROOF SHIELD © SB STEEL BEAM © SP STEEL POST © STP STEEL PLATFORM © TEL HOFFMAN BOX QS TGB TOWER GROUND BAR © TWR TOWER BASE 6D VP DIESEL FUEL VENT PIPE glL Contractor to provide #2 solid bare tin -clad (SBTC) copper wire lead from #1 ground ring to air conditioner & ice shield if provided by VZW. 1 RING. EXTERNAL BURIED w/ RODS /2 SBTC IA RING, CONCRETE ENCASED 12 SBTC 2 DEEP ANODE (TO IMPROVE OHMS) ROD OR PIPE 3 RING TO BLDG STL FRAME 12 SBTC 4 MAIN AC PANEL NEUTRAL BUS TO (2) GROUND RODS, ISOLATED FROM LEAD /1 NEC 250.66 5 RING TO GROUND BAR 2 2 SBTC 6 RING TO EXT MTL OBJECT 12 SBTC 7 DEEP ANODE TO MGB NSTD33-9 8 AC PANEL TO WATER METER NEC 250.66 9 EXT WATER TO INT WATER PIPES NSTD33-9 10 INT WATER PIPE TO MG8 NSTD33-9 11-12 NOT USED 13 AC PANEL TO MGB NSTD33-9 14 MGB/FGB TO BLDG STL FRAME 02/0 I-STR 14C MGB/FGB TO ROOF/WALL MTL PNL 11/0 I-STR 15 MGB/FGB TO FGB-HE SAME FLOOR 12/0 I-STR 16 NOT USED 16A ECPGB TO CABLE ENTRY RACK 11/U 1-Sim 17 MGB TO CABLE SHIELDING /6 I-STR 17A ECPGB TO CABLE SHIELDING 16 I-STR 17B MGB/FGB TO F-0 SPLICE SHELF 11 I -STIR 18 LOWEST MGB/FGB TO HIGHEST FGB 02/0 I-STR 19 LEAD 18 TO OTHER FG8s, <6' 12/0 I-STR 20 MGB/FGB TO BRANCH AC PNL 16 I-STR 20A NEAREST GRND TO DISCONNECT PNL NEC 250.66 20B GWB TO AC DISTR PNL 16 I-STR 21 MGB/FGB TO INT HALO 12 I-STR 21A INTERIOR 'GREEN' HALO 21B INT HALO TO EXT RING #2 I-STR 12 SBTC 21C INT HALO TO EQUIPMENT MTL #6 I-STR 22 ROOF TOWER RING TO ROOF GRND NFPA 780 23 MGB/FGB TO ECPGB, SAME FLOOR 11 I-STR 23A MGB/FG8 TO CXR-HF UNR PROT 16 I-STR 24 ECPGB TO EACH PROTECTOR ASSEMBLY 16 I-STR 24A LOWER PROT ASSY TO UPPER 16 I-STR 25 RING TO NEAREST LIGHTNING ROD #2 SBTC 26 LGHTNG ROD SYS TO NEARBY MTL NFPA 780 27 RING TO TOWER RING (2) 12 SBTC 28 RING TO SHELTER RING (2) /2 SBTC 29 BRANCH AC PNL TO BTTY CHG FRM NSTD33-11 30 BRANCH AC PNL TO OUTLETS NSTD33-11 31 MGB/FGB TO PWR, BTTY FRAMES 12/0 I-STR 32 131 TO BATTERY CHARGER FRAME 06 I-STR 33 131 TO BATTERY RACK FRAME 16 I-STR 34 131 TO PCU FRAME 16 I-STR 35 #31 TO DSU FRAME 16 I-STR 36 #31 TO PDU FRAME 16 I-STR 37 MGB/FGB TO BTTY RETURN NSTD33-14.5 37A MGB/FGB TO RTN TERM CARR SUPP #6 I-STR 38 FGB TO PDU GB 1750MCM I-STR 38A FGB TO PDU GB CARRIER SUPPLY 12/0 I-STR 39 DC BUS DUCT TO NEXT SECTION #6 I-STR 40 DC BUS DUCT TO MGB/FG8 16 I-STR 41A MGB/FGB TO 158 12/0 I-STR 42-44 NOT USED 45 MAIN AC PNL TO BRANCH AC PNL NSTD33-11 46 BRANCH AC PNL TO DED OUTLET NSTD33-11 47 FGB TO INTEG FIRM 12 I-STR 48 LEAD 131 TO INTEG FRM 16 I-STR 49 INTEG FRM TO EQUIP SHELF BY FASTENERS 50 PDU BTTY RET TO 151 12/0 I-STR 51 #50 TO TRANS FRM ISO DC PWR 16 I-STR 52 TRANS FRM FUSE TO FRM OR BAR 18 I-STR 53A MGB/FGB TO PDF/BDFB NSTD33-22 54 MGB/FGB TO STATIC DEVICES 16 I-STR 55 MGB/FGB TO CABLE AT ENTRY /6 1-STR 56 MGB/FGB TO AC PWR RADIO XMTTR #6 I-STR 57A MGB/FGB TO CBL GRID/RUNWAY 12/0 I-STR 58A 141A TO AISLE FRAME 12-STR 59A 158A TO EACH SGL FRAME GRND 16 I-STR 60-89 NOT USED 90 GENERATOR FRAME TO EXT RING 12 SBTC NOTE: REMOVE GALVANIZING FROM O 0 FENCE POSTS IN AREAS LUGS WILL BURNDY BE INSTALLED. LIGHTLY COAT THE YA6C 2TC 14 UNDERSIDE OF THE LUGS W/ CRIMP LUG ANTI-OX COMPOUND BEFORE ATTACHING TO POSTS. BELDEN f—, 11210 I.D. O TUBULAR BRAIDED TOP VIEW SIDE VIEW STRAP TWO -HOLE 10,000 PSI GATE BONDED TO FENCE POST HYTAP CONNECTOR COMPRESSION FITTING (2 TWO -HOLE 10,000 PSI COMPRESSION FITTING 10,000 PSI COMPRESSION FITTING UL 9498 LISTED w/3/4" BRAIDED TINNED COPPER JUMPER STRAP FITTING MUST BE UL467 LISTED ACCEPTABLE FOR DIRECT BURIAL YPE RJ WELDED, NOT CRIMPED TYPE RR REINF BAR 2 COMPRESSION CONNECTOR DETAILS SCALE: NONE TYPE VS TYPE VS ROUND SURFACE FLAT SURFACE WELD: THOMAS & BETTS, 54856BE BROWN33" CRIMP: BURNDY, YA3C 2TC 14E2, 10,000 PSI SCREW RECOGNIZED, EM 2522DH.75.312 • TYPE HS TYPE GT TYPE PT TYPE GL LUG EXOTHERMIC WELD DETAILS 1 SCALE:NONE .- J!.Dq LICENSED ARCHITECT 12427 Q M0 I hereby cerllh that this plan specrficatm or report was prepares by me or unde my drect supervrslon. and that I am a duct regatered Archnec. urK e. 'ne laws of the State of t.lnnesda ROBERT ! DA'.1S. Reg Ne 124: DESIGN hL 9973 VALLEY VIEW RD- EDEN PRAIRIE MN 55344 (952)903-9299 W W W.DESIGN 1 EP.COM verizo, , 10801 BUSH LAKE ROAD BLOOMINGTON. MN 55438 46121 72M052 I PROJECT I 20130877426 LOC. CODE: 265810 MIN MACAROON CC BU #878498 QUATTRO DRIVE CHANHASSEN. MN 55317 SHEET CONTENTS GROUNDING NOTES BY: G-1 0&3' -' 6 EMS 02-14-'7 a:-1a-17 NOTE: CONTRACTOR SHALL ENSURE THAT EACH WHIP IS ROUTED TO LEAD 1 BY THE SHORTEST PATH, AND BENDS SHALL NOT BE LESS THAN 12" RADIUS FP GP GP FP o �%T "IT / PREFERRED TEST �iz ------r----___t►________i-�V�WELL LOCATION GROUND RODS AT - T �� 20'-0' O.C. OR AS I SHOWN I ILC STP% R I ; IRBR PROPOSED EQUIPMENT TO BE I 1 GROUNDED PER MANUFACTURERS - SPECS AND �I ATTACHED TO MAN BUSS BAR R, 1. ' I r w1 R } , iR 11 % TEL w.l is x BI-DIRECTIONALS T • I I I i 1 1 I 1 1 I I O CBS W ' BI-DIRECTIONALS T j I I. 1I G��____________--�' / m , a 1 EL I I TOE I o 5 \�\ CBS% ASSUMED TOWER GROUND RING, CONTRACTOR TO VERIFY CBS GROUNDING DETAIL INDEXAirs i LICENSED _ ARCHITECT 12427 :`� � �� // \N\ // �\ DETAIL DETAIL DESCRIPTION PLATFORM 9'-4' X 14'-O' PLATFORM W' CANOPY GROUNDING ELEVATIONS "1 1 TEST WELL DETAIL GROUND RING 8 ROD DETAIL. ' 1.3 REBAR GROUNDING DETAIL ' 1.4 CONDUIT DETAIL '1 5 TYPICAL GROUNDING CABLE BRIDGE DETAIL I heresy cert,ty that Mrs plan spea6cation or report was preparers by me or under my dked supervision and that I am a duly registered Ara,tlect under the laws o1 the State of Minnesota ROBERT 1 DA'-. IS. Reg No 12427 E Date DESIGN K 9973 VALLEY VIEW RD. EDEN PRAIRIE. MN 55344 I9521903-9299 V,'AW' DESIGN EP.COM verizon� 10801 BUSH LAKE ROAD BLOOMINGTON MN 55438 (612, 720-0052 PROJECT I 20130877426 LOC. CODE: 265810 MIN MACAROON CC BU #878498 QUATTRO DRIVE CHANHASSEN. MN 55317 SHEET CONTENTS: GROUNDING PLAN GROUNDING DETAIL INDEX -------------- ,I - ----------<; , ' DRAWN BY. -© I DATE. CBS CBS 1 CHECKED BY I 1 REV A REV B I NORTH C --- �� T GROUNDING PLAN i � 1 GP -� -� _E ..._ G-2 02-14-17 04-10-1' 1. CONTRACTOR TO COORDINATE PUBLIC AND PRIVATE UTILITY LOCATES PRIOR TO CONSTRUCTION START. NOTIFY THE ARCHITECT AND THE VZW CONSTRUCTION ENGINEER IMMEDIATELY OF ANY UTILITY LINE ISSUES. 2. EXISTING UNDERGROUND UTILITY LOCATIONS ARE APPROXIMATE AND NOT ALL UTILITIES ARE SHOWN. CONTRACTOR IS RESPONSIBLE TO NOT DAMAGE UNDERGROUND UTILITIES AND MUST CONDUCT BOTH PUBLIC AND PRIVATE UTILITY LOCATES BEFORE EXCAVATING. 3 CONTRACTOR SHALL RESTORE ALL AREAS, INCLUDING LANDSCAPE, DISTURBED BY CONSTRUCTION TO PRE -CONSTRUCTION CONDITIONS. E, - LESSEE LAND SPACE - U3 I � I HANDHOLE/PULL CROWN CASTLE 20' UTILITY i COMPOUND I I I I AND ACCESS EASEMENT (_ -- L I, STING I ` f LDING7 "GilWru A ii E L {i . , I o_ _---! ---� I I I I I EXISTING I I f 0 I BUILDING I I I I I --=-_ - I I L----- 1 I - HN+DHOLF/PU.L BOX AT TRAn A . _-. LTY EASEN LINE F EXIS T , , N"v FlBEk, iYP. - 7/ — —_ — —— — — �/ 2 _ � -'=P.OPERTY LINE, TYP U-1 I ✓ / EXISTING UTILITY & UNDERGROUND FIBER CONDUIT WITH A TRACEABLE WIRE FROM DRAINAGE EASEMENT HANOHOLE/PULL BOX AT PROPERTY LINE, TO COMPOUND V PER PLAT OF QUATTRO ► VDIOLE/PULL BOX BY G.C., MINIMUM OF 42' BELOW ADDITION GRADE W/ 2 DETECTABLE RIBBONS, APPROX 440 LF NORTH 1 SITE UTILITY PLAN GWPW SCALE SCALE: 1- = 50*-0' u �• I EXISTING PROPERTY LINE, TYP. EXISTING UNC _ - - — — — — — ELECTRIC. Ti: — — — — 17' X 30' X 24'------__1 HANDHOLE/PULL BOX, 12' MAX. FROM RIGHT OF WAY. BY G.C. Ug0 11GI _ ' UGF" XISTING UNDERGROUND FIBER. TYP. k 1 FCC _ P ' 2 PULLBOX LOCATION PLAN SCALE: 114' = 1'-0- A LAND SPACE CROWN CASTLE LEASE AREA UNDERGROUND FIBER C=UIT WITH A TRACEABLE WLRE FROM HANDHOLE/PULL TO TELCO ENTRY BY G.C.. MINIMUM OF 42' POWER TYPE: 120/240V. SINGLE PHASE. 200 AMPS RANDHOLE/PULL BOX, LOCATED WITHIN PUBLIC RIGHT OF WAY INSTALLED BY UT FIBER PROVIDER FIBER DISTRIBUTION PEDESTAL MAY BE REQUIRED BY UTILITY PROUDER HANDHOLE/PULL BOX, LOCATED WITHIN PUBLIC RIGHT OF WAY INSTALLED BY DARK FIBER PROVIDER NORTH GRAPHC SCALE 0 2' 4' •I If 114 - -- x---- -- ---- x — x F — s_ UGE — UGE — !� X / I O BELOW GRADE W/ 2r _ DETECTABLE RIBBONS, yy� Dc1cFDI l APPROX 40 LF s x I� - I 17' X 30' X 24' I HANDHOLE/PULL BOX o AND UNDERGROUND I �' FIBER CONDUIT TO W TELCO BOX BY G.C. I -- I I I I � I NQT I CONTRACTOR TO ENSURE 36' CLEARANCE OF 13 TREES IN FRONT I I OF METER I I J� METER IN EXISTING 1� METER SOCKET (LABELED VERIZON WIRELESS) I I 0 1 I H-FRAME WITH I OPEN METER �� I SOCKET I 4 ILC f f i TELCO L------- -- 3 COMPOUND UTILITY PLAN SCALE 1 F' _ �J UNDERGROUND SECONDARY ELECTRICAL RUN FROM METER TO ILC BY G.C., MINIMUM OF 42' BELOW GRADE W/ 2 DETECTABLE RIBBONS, APPROX 70 LF 1 _ x L-- I. 7771x ]I' 1 f FIBER, TYP. Jx x 1 x 1 x I J.D.. L LICENSED ARCHITECT = 12427 \ I herehy cert6 That his plan spedfinahon or report via, prepared by me or under m, supervi— and hat I arr regmtered Archd l un._ the Iaxs of the Stale of Misr ROBERT J DAVIS Rep N DESIGN 9973 VALLEY VIEW RD. EDEN PRAIRIE. MN 55344 4952)903-9299 W W W.DESIGN 1 EP.COM Ill verizom' 10801 BUSH LAKE ROAD BLOOMINGTON MN -c (E12) 720d052 PROJECT I 20130877426 LOC. CODE: 265810 MIN / MACAROON CC BU #878498 QUATTRO DRIVE CHANHASSEN. MN 55317 SHEET CONTENTS: SITE UTILITY PLAN / PULLBOX LOCATION PLAN COMPOUND UTILITY PLAN NORTH GRAPHC SCALE 0 r e• DRAWN BY: DJS DATE: 06-31-16 CHECKED BY: BMS REV. A 02-14-17 U-1 PID.0711622310071 HERMAN HOLDINGS ONE LLC JL 2. i - - - - - - 9y & :).c�^.cge Ecser— ------------ - LOT 1 BLOCK 1 o� LU f:. I� F- PID.0711622340018 x a BEDDOR ENTERPRISES x oow A O W.. +Fix _yam• I n -U.1 n � — N 2 WEST 77TH STREET O J Ci W a m r SITE SURVEY PID:0711622340017 DELL ROAD PARTNERS LLP LEGEND TREE CONIFER CENTER LINE TREE DECIDUOUS EDGE OF WOODS - - WATER HYDRANT - ` - - FENCE CHAIN LINK UNDERGROUND GAS X' WATER VALVE UNDERGROUND FIBER OPTIC g ELEC METER -- .icT - UNDERGROUND TELEPHONE T TELE PEDESTAL - -- ice--- UNDERGROUND ELECTRIC GAS METER SECTION LINE FENCE POST QUARTER LINE ELEC HANDHOLE RIGHT OF WAY LINE BOUNDARY LINE STORM CATCH BASIN EASEMENT LINE MAILBOX ELEC TRANSFORMER BOX BUILDING WALL HATCH X GROUND ACCESS COVER ` CONCRETE SURFACE CITY 1 "=600' 3 VICINITY MAP w a Z rn OF I EXISTING j TOWER SITE � L_ D O CHANHASSAN Q > 77TH ST, W _ Q I J = J LU i 78TH ST. W do STATE TRUNK HIGHWAY NO. 5 W Q = GRID- H GEODETIC NORTH MAGNETIC NORTH NORTH - c0 a - , z _ a w eo- SURVEYOR NOTES: SCALE I Of FM 1 ORWWAT OirI 111 lG Svxsti^^y Monopole Ce^ter en5r:.o aw TIE u o" cou,Tv utll4ies ore Der ooserveo evicer,ce and f orn I' I Gro„^c E,evctior- 932.0 NAVD88 ^�orkings pc GOPHER STATE ONE CALF Locate coovow.rE sysrEV RAosa uc 1"=j' -'< Top o` Steel Elevotron= '000. NAV088 r, Requnt Ticket No. 16'750888, doted June 24, • - oeROTes AFourro sFCTOR coRra� -ti --r- Teuest APourtenonce Eer-'CC<„ NAV088 4 2016. Also morkinos Der Honce Private ._ocet nc vDlAla6 DETAIL " LoYtuoe= Naa' s : cE" NA83 O nt I HEREBY CERTIFY THA- THIS MCJVENT WAS PREPARED 131" SITE NAME: AND THATI DESIGN MINC MACAROON WIDSETH SMITH NOLTING �P ~ `- Hennepin County. MN C2��•`,v` 10.4.94A�19�68j.Ooo -- _ Engineering I Architecture I Surveying I Environmental Ne. Dx,, REVISIONS CHK APED p --AAA Y •�_-"- - - FIELD WORK -' 16 CHECKED BY SMK DRAWN BY `' JMB - =�== * <g-2 a n%Wore THs THa Trn PROJECT DESCRIPTION: EXTENSION DRAWINGS FOR A 67' MONOPOLE CROWN CASTLE ATTENTION ALL CONTRACTORS, ANYTIME YOU ACCESS A CROWN SITE FOR ANY REASON YOU ARE TO CALL THE CROWN NOC UPON ARRIVAL AND DEPARTURE, DAILY AT 800-788-7011. QUALIFIED ENGINEERING SERVICES ARE AVAILABLE FROM FDH VELOCITEL TO ASSIST CONTRACTORS IN CLASS IV RIGGING PLAN REVIEWS. TO REQUEST QUALIFIED ENGINEERING SERVICES. PLEASE CONTACT FDH VELOCITEL AT RIGGING@FDHVELOCITEL.COM OR (919) 755-1012 PROJECT DATA CODES AND STANDARDS BUILDING CODE 2012 INTERNATIONAL BUILDING CODE TIA STANDARD ANSIrTIA-222-G ULTIMATE WIND SPEED WITHOUT ICE (MPH) 115 NOMINAL WIND SPEED WITH ICE (MPH) 50 SERVICE WIND SPEED (MPH) 60 ICE THICKNESS (INN 0.75 EXPOSURE CATEGORY B STRUCTURE CLASSIFICATION II TOPOGRAPHIC CATEGORY 1 CREST HEIGHT (FT) 0 SS(GI 0.050 S. (G) 0.028 PROJECT CONTACTS CCI PROJECT MANAGER NAME JARED POULETTE CCI PROJECT MANAGER EMAIL ADDRESS JARED.POULETTEQCROWNCASTLE_COM CCI PROJECT MANAGER PHONE NUMBER (3141513-0149 CCI CONSTRUCTION MANAGER NAME CHAD HILTNER CCI CONSTRUCTION MANAGER EMAIL ADDRESS CHAD.HILTNEROCROWNCASTLE. COM CCI CONSTRUCTION MANAGER PHONE NUMBER (7631852-0592 FDH VELOCITEL PROJECT ENGINEER NAME KELSEY SARGENT. El FDH VELOCITEL PROJECT ENGINEER EMAIL ADDRESS KELSEY.SARGENT@FDHVELOCITELCOM FDH VELOCITEL PROJECT ENGINEER PHONE NUMBER (919) 755-1012 SITE NAME. BEDDOR ENTERPRISES SITE NUMBER: 878498 SITE ADDRESS: 7700 QUATTRO CHANHASSEN, MN 55317 C0GRD1%ATES LAT: 44.8648' LONG:-93.5153' PASSING STRUCTURAL ANALYSIS STRUCTURAL ANALYSIS COMPANY CROWN CASTLE PROJECT NO. 1294289 DATE NOVEMBER 15. 2016 WORK ORDER* 1294289 CCI DOC# 6444617 PASSING STRUCTURAL ANALYSIS / MODIFICATION DRAWINGS STRUCTURAL ANALYSIS COMPANY FDH VELOCITEL PROJECT NO. 16PXJY2400 DATE DECEMBER 15. 2016 SDD WORK ORDER* 1333733 CARRIER NAME VERIZON WIRELESS APPLICATION 359616 REV_ 5 TOWER MANUFACTURER ENGINEERED ENDEAVORS INCORPOR�- JOB# GS52841 THIS REPORT WAS BASED ON A SPECIFIC ANTENNA AND COAX CONFIGURATION PROVIDED BY THE TOWER OWNER. ANY CHANGE TO THIS INFORMATION MUST BE REVIEWED BY FDH VELOCITEL. ALL CONSTRUCTION SHALL COMPLY WITH THE TIA-1019-A STANDARD EPAP.EII Ft. VELOCITEL j F— 1c "'C—IloN -REPARED FOR CROWN CASTLE PROFESSI _ L ENGIS NE hereby mrl that. miss plan, speCifAm ion, or rep.^rt was mved by me or udder my dared suoerVISbDn J that I Rm a duly Licensed Prolemone Sneer under the taws of ft State of Min p� �fT1e a Dennis . A"el signature: f DNA 17, Ip Lcense x 41120 SHEET INDEX SHEET DESCRIPTION REV. S-• TITLE SHEET 0 S-2 MODIFICATION INSPECTION CHECKLIST 0 S-3 GENERAL NOTES 0 S-4 MODIFICATION SCHEDULE & BASE LEVEL LAYOUT 0 S-5 PIPE EXTENSTION INSTALLATION DETAILS 1 0 S£ PIPE EXTENSTION INSTALLATION DETAILS 11 0 12 15;16 DENNIS D. ABEL PE IMINNESOTA LIC. NO. 41120 DRAWN BY: WJD CHECKED BY. KLS ENG APPVD. DDA SUBMITTALS DATE DESCRIPTION REl 12/1S16 CONSTRUCTION 0 THE INFORMATION CONTAINED IN THIS SET OF DOCUMENTS IS PROPRIETARY BY NATURE. REPRODUCTION OR CAUSING TO BE REPRODUCED THE WHOLE OR ANY PART OF THESE DRAWINGS WITHOUT THE PERMISSION OF FDH VELOCITEL IS PROHIBITED FDH VELOCITEL PROJECT NUMBER 16PXJY2400 BEDDOR ENTERPRISES 878498 7700 QUATTRO CHANHASSEN. MN 55317 SHEET TITLE TITLE SHEET SHEET NUMBER S-1 ='PEPA-EC B' MI CHECKLIST INSPECTIONS AND TESTING REQUIRED REPORT ITEM PRE -CONSTRUCTION X MI CHECKLIST DRAWING X FOR APPROVAL X FABRICATION INSPECTION X FABRICATOR CERTIFIED WELD INSPECTION X MATERIAL TEST REPORT WTRI X FABRICATOR NOE INSPECTION N/A NDE REPORT OF MONOPOLE BASE PLATE X PACKING SLIPS ADDITIONAL TESTING AND INSPECTIONS. CONSTRUCTION X CONSTRUCTION INSPECTIONS N/A FOUNDATION INSPECTIONS N/A CONCRETE COMPRESSIVE STRENGTH AND SLUMP TESTS N/A POST INSTALLED ANCHOR ROD VERIFICATION N/A BASE PLATE GROUT VERIFICATION N/A CONTRACTOR'S CERTIFIED WELD INSPECTION AND NDE REPORTS N/A EARTHWORK. LI-T AND DENSITY X ON SITE COLD GALVANIZATIONS N/A GUI' WIRE TENSION REPORT X GC AS BUILT DOCUMENTS ,'.DD'TIONAL TESTING AND INSPECTIONS. POST -CONSTRUCTION X MI INSPECTOR. REDLINE OR RECORD DRAWINGS N/A POST INSTALLED ANCHOR ROD PULL-OUT TESTING X PHOTOGRAPHS ADDITIONAL TESTING AND INSPECTIONS: NOTE. X DENOTES A DOCUMENT NEEDED FOR THE PMI REPORT N'A DENOTES A DOCUMENT THAT IS NOT REQUIRED FOR THE PMI REPORT MODIFICATION INSPECTION NOTES: GENERAL: THE MODIFICATION INSPECTION (MI) IS A VISUAL INSPECTION OF TOWER MODIFICATIONS AND A REVIEW OF CONSTRUCTION INSPECTIONS AND OTHER REPORTS TO ENSURE THE INSTALLATION WAS CONSTRUCTED IN ACCORDANCE WITH THE CONTRACT DOCUMENTS, NAMELY THE MODIFICATION DRAWINGS. AS DESIGNED BY THE ENGINEER OF RECORD (EOR). THE MI IS TO CONFIRM INSTALLATION CONFIGURATION AND WORKMANSHIP ONLY AND IS NOT A REVIEW OF THE MODIFICATION DESIGN ITSELF. NOR DOES THE MI INSPECTOR TAKE OWNERSHIP OF THE MODIFICATION DESIGN. OWNERSHIP OF THE STRUCTURAL MODIFICATION DESIGN EFFECTIVENESS AND INTEGRITY RESIDES WITH THE FOR AT ALL TIMES. ALL MI'S SHALL BE CONDUCTED BY A CROWN ENGINEERING VENDOR (AEV) OR ENGINEERING SERVICE VENDOR tAESV) THAT IS APPROVED TO PERFORM ELEVATED WORK FOR CROWN. SEE ENG-BUL-10173 LIST OF APPROVED MI VENDORS. TO ENSURE THAT THE REQUIREMENTS OF THE MI ARE MET. IT IS VITAL THAT THE GENERAL CONTRACTOR (GC, AND THE MI INSPECTOR BEGIN COMMUNICATING AND COORDINATING AS SOON AS A PO IS RECEIVED. IT IS EXPECTED THAT EACH PARTY WILL BE PROACTIVE IN REACHING OUT TO THE OTHER PARTY. IF CONTACT INFORMATION IS NOT KNOWN. CONTACT YOUR CROWN POINT OF CONTACT (POC). REFER TO ENG-SOW-10007 . MODIFICATION INSPECTION SOW FOR FURTHER DETAILS AND REQUIREMENTS. MI INSPECTOR: THE MI INSPECTOR IS REQUIRED TO CONTACT THE GC AS SOON AS RECEIVING A PO FOR THE MI TO AT A MINIMUM. • REVIEW THE REQUIREMENTS OF THE MI CHECKLIST • WORK WITH THE GC TO DEVELOP A SCHEDULE TO CONDUCT ON -SITE INSPECTIONS. INCLUDING FOUNDATION INSPECTIONS THE MI INSPECTOR IS RESPONSIBLE FOR COLLECTING ALL GENERAL CONTRACTOR (GC) INSPECTION AND TEST REPORTS, REVIEWING THE DOCUMENTS FOR ADHERENCE TO THE CONTRACT DOCUMENTS. CONDUCTING THE IN -FIELD INSPECTIONS. AND SUBMITTING THE MI REPORT TO CROWN. GENERAL CONTRACTOR: THE GC IS REQUIRED TO CONTACT THE MI INSPECTOR AS SOON AS RECEIVING A PO FOR THE MODIFICATION INSTALLATION OR TURNKEY PROJECT TO. AT A MINIMUM- • REVIEW THE REQUIREMENTS OF THE MI CHECKLIST • WORK WITH THE MI INSPECTOR TO DEVELOP A SCHEDULE TO CONDUCT ON -SITE MI INSPECTIONS INCLUDING FOUNDATION INSPECTIONS • BETTER UNDERSTAND ALL INSPECTION AND TESTING REQUIREMENTS THE GC SHALL PERFORM AND RECORD THE TEST AND INSPECTION RESULTS IN ACCORDANCE WITH THE REQUIREMENTS OF THE MI CHECKLIST AND ENG-SOW-10007. RECOMMENDATIONS: THE FOLLOWING RECOMMENDATIONS AND SUGGESTIONS ARE OFFERED TO ENHANCE THE EFFICIENCY AND EFFECTIVENESS OF DELIVERING A MI REPORT • IT IS SUGGESTED THAT THE GC PROVIDE A MINIMUM OF 5 BUSINESS DAYS NOTICE. PREFERABLY 10. TO THE MI INSPECTOR AS TO WHEN THE SITE WILL BE READY FOR THE MI TO BE CONDUCTED. • THE GC AND MI INSPECTOR COORDINATE CLOSELY THROUGHOUT THE ENTIRE PROJECT. • WHEN POSSIBLE. IT IS PREFERRED TO HAVE THE GC AND MI INSPECTOR ON -SITE SIMULTANEOUSLY FOR ANY GUY WIRE TENSIONING OR RE -TENSIONING OPERATIONS. • IT MAY BE BENEFICIAL TO INSTALL ALL TOWER MODIFICATIONS PRIOR TO CONDUCTING THE FOUNDATION INSPECTIONS TO ALLOW FOUNDATION AND MI INSPECTION(S) TO COMMENCE WITH ONE SITE VISIT. • WHEN POSSIBLE. IT IS PREFERRED TO HAVE THE GC AND MI INSPECTOR ON -SITE DURING THE MI TO HAVE ANY DEFICIENCIES CORRECTED DURING THE INITIAL MI. THEREFORE. THE GC MAY CHOOSE TO COORDINATE THE MI CAREFULLY TO ENSURE ALL CONSTRUCTION FACILITIES ARE AT THEIR DISPOSAL WHEN THE MI INSPECTOR IS ON SITE. CANCELLATION OR DELAYS IN SCHEDULED MI: IF THE GC AND MI INSPECTOR AGREE TO A DATE ON WHICH THE MI WILL BE CONDUCTED. AND EITHER PARTY CANCELS OR DELAYS. CROWN SHALL NOT BE RESPONSIBLE FOR ANY COSTS. FEES. LOSS OF DEPOSITS ANDIOR OTHER PENALTIES RELATED TO THE CANCELLATION OR DELAY INCURRED BY EITHER PARTY FOR ANY TIME (E-G. TRAVEL AND LODGING. COSTS OF KEEPING EQUIPMENT ON -SITE. ETC.). IF CROWN CONTRACTS DIRECTLY FOR A THIRD PARTY MI. EXCEPTIONS MAY BE MADE IN THE EVENT THAT THE DELAY/CANCELLATION IS CAUSED BY WEATHER OR OTHER CONDITIONS THAT MAY COMPROMISE THE SAFETY OF THE PARTIES INVOLVED. CORRECTION OF FAILING MI'S: IF THE MODIFICATION INSTALLATION WOULD FAIL THE MI r FAILED MI-). THE GC SHALL WORK WITH CROWN TO COORDINATE A REMEDIATION PLAN IN ONE OF TWO WAYS: • CORRECT FAILING ISSUES TO COMPLY WITH THE SPECIFICATIONS CONTAINED IN THE ORIGINAL CONTRACT DOCUMENTS AND COORDINATE A SUPPLEMENT MI. • OR. WITH CROWN'S APPROVAL THE GC MAY WORK WITH THE FOR TO RE -ANALYZE THE MODIFICATION/REINFORCEMENT USING THE AS -BUILT CONDITION MI VERIFICATION INSPECTIONS: CROWN RESERVES THE RIGHT TO CONDUCT A MI VERIFICATION INSPECTION TO VERIFY THE ACCURACY AND COMPLETENESS OF PREVIOUSLY COMPLETED MI INSPECTION(S) ON TOWER MODIFICATION PROJECTS. ALL VERIFICATION INSPECTIONS SHALL BE HELD TO THE SAME SPECIFICATIONS AND PROFESSIC REQUIREMENTS IN THE CONTRACT DOCUMENTS AND IN ACCORDANCE WITH ENG-SOW 1QQQi,-gp� cerl repol was p VERIFICATION INSPECTION MAY BE CONDUCTED BY AN INDEPENDENT AEWAESV FIRM FSTERA _5 MODIFICATION PROJECT IS COMPLETED. AS MARKED BY THE DATE OF AN ACCEPTED DF('�� -PASSING MIOR `PASS AS NOTED MI" REPORT FOR THE ORIGINAL PROJECT. Profess'ona. State of Mini Print Name REQUIRED PHOTOS: Slgneture _ BETWEEN THE GC AND THE MI INSPECTOR THE FOLLOWING PHOTOGRAPHS. AT A MINI UM. ARE TO BE TAKEN AND INCLUDED IN THE MI REPORT: Date I L-! PRE -CONSTRUCTION GENERAL SITE CONDITION PHOTOGRAPHS DURING THE REINFORCEMENT MODIFICATION CONSTRUCTION/ERECTION AND INSPECTION •• RAW MATERIALS •• PHOTOS OF ALL CRITICAL DETAILS •• FOUNDATION MODIFICATIONS •• WELD PREPARATION •• BOLT INSTALLATION AND TORQUE •• FINAL INSTALLED CONDITION •• SURFACE COATING REPAIR POST CONSTRUCTION PHOTOGRAPHS •• FINAL INFIELD CONDITION PHOTOS OF ELEVATED MODIFICATIONS TAKEN FROM THE GROUND SHALL BE CONSIDERED INADEQUATE THIS IS NOT A COMPLETE LIST OF REQUIRED PHOTOS. PLEASE REFER TO ENG-SOW-10007 a VELOCITEL ENGiNEEP�hG NNO\'PTiCN =REPAREDFDR. CROWN CASTLE L ENGIWE13 1a' Pvt plan, spearficat)on. or ved by me or under my direct that I am a duty 'Licensed Iineer under the :aws of the Itfl Dennis. Adel Licens41'I 20 DENNIS D. ABEL PE MINNESOTA LIC. NO. 41120 DRAWN BY: WJD CHECKED BY. KLS ENG APPVD. DDA SUBMITTALS DATE DESCRIPTION RE, 12l1516 CONSTRUCTION THE INFORMATYJN CONTAINED IN THIS SET OF :CUTAENTS IS PROPRIETARN BN NATURE REPROOMTION uR CAUSING TO BE REPRODUCED THE NHOLE OR AN\" =ART OF THESE DRAWINGS WITHOUT THE PERMISSION OF FOH VELOCITEL IS PROHIBITED FDH VELOCITEL PROJECT NUMBER. 16PXJY2400 SITE NAME BEDDOR ENTERPRISES 878498 7700 QUATTRO CHANHASSEN, MN 55317 SHEET TITLE MODIFICATION INSPECTION CHECKLIST S-2 RAL NOTES: ALL WORK SHALL BE DONE IN ACCORDANCE WITH ALL APPLICABLE FEDERAL. STATE AND LOCAL CODES AND ORDINANCES. IT IS THE CONTRACTOR'S RESPONSIBILITY TO OBTAIN ALL PERMITS NECESSARY TO COMPLETE THE PROJECT AND ABIDE BY ALL CONDITIONS AND REQUIREMENTS OF THE PERMITS. 2 THE CONTRACTOR SHALL BE RESPONSIBLE FOR VERIFICATION OF ALL DIMENSIONS, ELEVATIONS AND EXISTING CONDITIONS AT THE SITE BEFORE ORDERING ANY MATERIALS OR DOING ANY WORK. NO EXTRA CHARGE OR COMPENSATION SHALL BE ALLOWED DUE TO DIFFERENCE BETWEEN ACTUAL DIMENSIONS AND DIMENSIONS INDICATED ON THE CONSTRUCTION DRAWINGS. ANY SUCH DISCREPANCY IN DIMENSION WHICH MAY BE FOUND SHALL BE SUBMITTED TO FDH VELOCITEL FOR CONSIDERATION BEFORE THE CONTRACTOR PROCEEDS WITH THE WORK IN THE AFFECTED AREAS. 3. INCORRECTLY FABRICATED. DAMAGED. OTHERWISE MISFITTING. OR NON -CONFORMING MATERIALS AND CONDITIONS SHALL BE REPORTED TO FDH VELOCITEL PRIOR TO ANY REMEDIAL OR CORRECTIVE ACTION. ALL ACTIONS SHALL REQUIRE FDH VELOCITEL APPROVAL. 4 IT IS THE CONTRACTOR'S SOLE RESPONSIBILITY TO DETERMINE ERECTION PROCEDURE AND SEQUENCE TO ENSURE THE SAFETY OF THE STRUCTURE AND ITS COMPONENT PARTS DURING ERECTION AND,OR FIELD MODIFICATIONS THIS INCLUDES- BUT IS NOT LIMITED TO THE ADDITION OF TEMPORARY BRACING GUYS OR TIE DOWNS THAT MAY BE NECESSARY_ SUCH MATERIAL SHALL BE REMOVED AFTER THE COMPLETION OF THE PROJECT 5. CONTRACTOR SHALL PROMPTLY REMOVE ANY 8 ALL DEBRIS FROM SITE AND RESTORE AS BEST AS POSSIBLE TO PRECONSTRUCTION CONDITION 6, ALL CONSTRUCTION MEANS AND METHODS. INCLUDING BUT NOT LIMITED TO. ERECTION PLANS. RIGGING PLANS. CLIMBING PLANS. AND RESCUE PLANS SHALL BE THE RESPONSIBILITY OF THE GENERAL CONTRACTOR RESPONSIBLE FOR THE EXECUTION OF THE WORK CONTAINED HEREIN AND SHALL MEET ANSLTIA 1019 (LATEST EDITION). OSHA. AND GENERAL INDUSTRY STANDARDS. ALL RIGGING PLANS SHALL ADHERE TO ANSI TIA-1019 (LATEST EDITION I INCLUDING THE REQUIRED INVOLVEMENT OF A QUALIFIED ENGINEER FOR CLASS IV CONSTRUCTION. 7. THE CLIMBING FACILITIES. SAFETY CLIMB AND ALL PARTS THEREOF SHALL NOT BE IMPEDED, MODIFIED OR ALTERED WITHOUT THE EXPRESS WRITTEN APPROVAL OF THE ENGINEER OF RECORD. 8. ANY WORK PERFORMED WITHOUT A PREFABRICATION MAPPING IS DONE AT THE RISK OF THE GC AND OR FABRICATOR CONTRACTOR QUALIFICATION NOTES: 1 ALL REPAIRS SHALL BE PERFORMED BY A TOWER CONTRACTOR WITH A MINIMUM 5 YEARS EXPERIENCE IN TOWER ERECTION AND RETROFIT AND WITH WORKING KNOWLEDGE OF THE ANSI/TIA-222-G 'STRUCTURAL STANDARD FOR ANTENNA SUPPORTING STRUCTURES AND ANTENNAS-. 2, CONTRACTOR IS RESPONSIBLE FOR ALL CONSTRUCTION MEANS AND METHODS. SHOULD THE CONTRACTOR REQUIRE DIRECT CONSULTATION. FDH VELOCITEL IS WILLING TO OFFER SERVICES BASED UPON AN AGREED FEE FOR THE WORK REQUIRED- 3. ALL SUBMITTAL INFORMATION MUST BE SENT TO FDH VELOCITEL 6521 MERIDIEN DRIVE. RALEIGH NC 27616. TEL (919) 755-1012. FAX. (919) 755-1031. E-MAIL STRUCTURALLFDHVELOCITELCOM. ANY VARIATION OF THESE SPECIFICATIONS OR DRAWINGS WITHOUT CONSENT FROM FDH VELOCITEL WILL VOID ANY RESPONSIBILITY OR LIABILITY FOR DAMAGE (MATERIAL OR PHYSICAL( TOWARDS FDH VELOCITEL 4_ ALL CONSTRUCTION TO BE IN ACCORDANCE WITH THE TIA-1019-A STANDARD JOB SITE SAFETY & NOTES: NEITHER THE PROFESSIONAL ACTIVITIES OF FDH VELOCITEL NOR THE PRESENCE OF FDH VELOCITEL OR EMPLOYEES AND SUB -CONSULTANTS AT THE CONSTRUCTION SITE. SHALL RELIEVE THE GENERAL CONTRACTOR AND OR SUBCONTRACTORS AND ANY OTHER ENTITY OF THEIR OBLIGATIONS. DUTIES AND RESPONSIBILITIES INCLUDING. BUT NOT LIMITED TO. CONSTRUCTION MEANS. METHODS. SEQUENCE. TECHNIQUES OR PROCEDURES NECESSARY FOR PERFORMING. SUPERINTENDING OR COORDINATING ALL PORTIONS OF THE WORK OF CONSTRUCTION IN ACCORDANCE WITH THE CONTRACT DOCUMENTS AND ANY HEALTH OR SAFETY PRECAUTIONS REQUIRED BY ANY REGULATORY AGENCIES- THE GENERAL CONTRACTOR AND OR SUBCONTRACTOR IS SOLELY RESPONSIBLE FOR JOB SAFETY_ AND WARRANTS THAT THIS INTENT IS EVIDENT BY ACCEPTING THIS WORK. STEEL: 1. ALL STRUCTURAL STEEL SHALL BE FABRICATED AND ERECTED IN ACCORDANCE WITH THE LATEST AISC CODE AND ASTM SPECIFICATIONS. 2. ALL CONNECTIONS OF STRUCTURAL STEEL MEMBERS SHALL BE MADE USING SPECIFIED WELDS WITH WELDING ELECTRODES NOTED IN THE STEEL GRADE SCHEDULE OR SPECIFIED HIGH STRENGTH BOLTS TO BE ASTM A325N. THREAD INCLUDED WITH SHEAR PLANE (UNLESS OTHERWISE NOTED). 3- ALL BOLTED CONNECTIONS TO BE INSTALLED TO A SNUG -TIGHTENED CONDITION IN ACCORDANCE WITH AISC 13 PART 16.2.'SPECIFICATION FOR STRUCTURAL JOINTS USING ASTM A325 OR A490 BOLTS'. SECTION 8.1. UNLESS OTHERWISE SPECIFIED. WHEN -X-TYPE BOLTS ARE USED. CONTRACTOR MAY BE REQUIRED TO STACK ADDITIONAL WASHERS TO OBTAIN PROPER SNUG TIGHT INSTALLATION. ALL NUTS SHALL BE HEAVY HEX UNLESS OTHERWISE NOTED. 4. ALL STEEL. AFTER FABRICATION. SHALL BE HOT DIPPED GALVANIZED PER ASTM A-123- ALL DAMAGED SURFACES. WELDED AREAS AND AUTHORIZED NON -GALVANIZED MEMBERS OR PARTS IEXISTING OR NEW) SHALL BE PAINTED WITH MULTIPLE COATS OF ZRC COLD GALVANIZING COMPOUND ACHEIVING A MINIMUM OF 4 MILS DRY FILM PER ASTM A 780. 5. ALL SHOP AND FIELD WELDING SHALL BE DONE BY WELDERS QUALIFIED AS DESCRIBED IN THE'AMERICAN WELDING SOCIETY'S STANDARD QUALIFICATION PROCEDURE' TO PERFORM THE TYPE OF WORK REQUIRED. CONTRACTOR IS REQUIRED TO PROVIDE FDH VELOCITEL WITH A PASSING CERTIFIED WELDING INSPECTION FOR ALL WELDS. 6. STRUCTURAL STEEL MAY NOT BE TORCH CUT FOR FABRICATION. ALL STEEL FABRICATION MUST FOLLOW AISC STANDARDS. MISC. NOTES: ALL MODIFICATIONS ARE ASSUMED TO BE MADE ON AN EMPTY TOWER. CONTRACTOR IS RESPONSIBLE TO MAKE PROVISIONS TO SUPPORT OR WORK AROUND EXISTING ANTENNAS AND TRANSMISSION LINES. MODIFICATIONS MUST BE CONTINUOUS THROUGH ALL AREAS SHOWN. 2 CONTRACTOR FIELD VERIFY ALL DIMENSIONS PRIOR TO CONSTRUCTION FABRICATION NOTES: 1. ALL DIMENSIONS ARE PRELIMINARY UNTIL FIELD VERIFIED BY CONTRACTOR. ANY CHANGES MUST BE APPROVED BY ENGINEER OF RECORD IN WRITING PRIOR TO FABRICATION AND INSTALLATION. 2. NEW STEEL MEMBERS MUST HAVE SINGLE DRILLED HOLES. SLOTTED AND DOUBLE DRILLED HOLES ARE NOT ACCEPTABLE MEANS OF FABRICATION SUBSTITUTES AND/OR EQUALS: IF CONTRACTOR WISHES TO FURNISH OR USE A SUBSTITUTE ITEM OF MATERIAL OR EQUIPMENT. CONTRACTOR SHALL FIRST MAKE WRITTEN APPLICATION TO ENGINEER OF RECORD FOR ACCEPTANCE THEREOF. CERTIFYING THAT THE PROPOSED SUBSTITUTE WILL PERFORM ADEQUATELY THE FUNCTIONS AND ACHIEVE THE RESULTS CALLED FOR BY THE GENERAL DESIGN. BE SIMILAR IN SUBSTANCE TO THAT SPECIFIED AND SUITED TO THE SAME USE AS THAT SPECIFIED. ALL VARIATIONS OF THE PROPOSED SUBSTITUTE FROM THAT SPECIFIED WILL BE IDENTIFIED IN THE APPLICATION AND AVAILABLE MAINTENANCE. REPAIR AND REPLACEMENT SERVICE WILL BE INDICATED. THE APPLICATION WILL ALSO CONTAIN AN ITEMIZED ESTIMATE OF ALL COSTS OR CREDITS THAT WILL RESULT DIRECTLY OR INDIRECTLY FROM ACCEPTANCE OF SUCH SUBSTITUTE INCLUDING COSTS OF REDESIGN AND CLAIMS OF OTHER CONTRACTORS AFFECTED BY THE RESULTING CHANGE. ALL OF WHICH WILL BE CONSIDERED BY ENGINEER OF RECORD IN EVALUATION OF THE PROPOSED SUBSTITUTE. ENGINEER OF RECORD MAY REQUIRE CONTRACTOR TO FURNISH ADDITIONAL DATA ABOUT THE PROPOSED SUBSTITUTE. COLD GALVANIZATION/SURFACE PREPARATION NOTES: 1. CONTRACTOR TO USE ZINGA OR ZRC COLD GALVANIZATION COMPOUNDS OR APPROVED EQUIVALENT. 2. PREPARE RUSTED/CORRODED SURFACE FOR TREATMENT ACCORDING TO MANUFACTURER'S RECOMMENDATIONS. 3. CONTRACTOR TO APPLY 12) COATS OF COLD GALVANIZATION COMPOUND PER MANUFACTURER'S RECOMMENDATION. DRYING AND CURING TIMES MUST BE UTILIZED PER MANUFACTURER'S RECOMMENDATION. 4. APPLY ALL COATINGS BY BRUSH IN CALM WIND CONDITIONS. THE USE OF AEROSOL IS NOT PERMITTED. 5. IF THE TOWER IS PAINTED. BRUSH PAINT ALL TREATED AREAS TO MATCH TOWER AFTER COLD GALVANIZATION COMPOUND IS ALLOWED TO CURE SAFETY CLIMB NOTES: 1. CONTRACTOR TO INSTALL TUF-TUG CABLE SAFE CLIMB SYSTEM UNLESS OTHERWISE NOTED. USE OF A SUBSTITUTE CLIMB SYSTEM IS ACCEPTABLE. CONTRACTOR SHALL FIRST MAKE WRITTEN APPLICATION TO ENGINEER OF RECORD FOR ACCEPTANCE THEREOF. CERTIFYING THAT THE PROPOSED SUBSTITUTE WILL PERFORM ADEQUATLY THE FUNCTIONS AND ACHIEVE THE RESULTS CALLED FOR BY THE GENERAL DESIGN NEW TUF-TUG CABLE SAFE CLIMB SYSTEM AND ASSOCIATED HARDWARE SHOULD BE PURCHASED DIRECTLY FROM THE MANUFACTURER POINT OF CONTACT LISTED BELOW AND INSTALLED PER MANUFACTURER RECOMMENDATIONS. JOEY DEUER TUF-TUG PRODUCTS 3434 ENCRETE LANE MORAINE. OH 45439 PHONE- (9371299-1213 FAX: (937, 299-0120 WEBSITE: WWW.TUF-TUG.COM EMAIL' TUFTUG@AOL.COM STEEL GRADE SCHEDULE SCOPE SHAPE GRADE YIELD STRENGTH (Fy) ULTIMATE STRENGTH (F,,) MONOPOLE EXTENSION PIPE A53 GR E 35 KSI 60 KSI ALL PLATE A3E 36 KSI 58 KSI ALL HELD ELECTRODE E-80XX BO KSI PEPAEL 0 VELOCITEL PREPAREDFOR CROWN CASTLE PROFESS( 4 fAL ENGINEEy I hereby cert the ttvs p:an, specrfication, or report was p 9, ared by rite or under rry d+rect sjoelAsan 1 13 that I am a du+y LcenSed Prc'erslona g!neer under the :avr of the Stele of M r. Print Name cta Dennis D. el Signature Date f U0111 # 41120 DENNIS D. ABEL PE MINNESOTA LIC. NO. 41120 DRAWN BY. WJD CHECKED BY. KLS ENG APPV'D. DDA SUBMITTALS DATE DESCRIPTION RE`. 1211516 CONSTRUCTION THE INFORMATION CONTAINED IN THIS SET OF DOCUMENTS IS PROPRIETARY BY NATURE REPRODUCTION OR CAUSING TO BE REPRODUCED THE 'A'HOLE OR ANY PART OF THESE DRAWINGS '.YRHOUT THE PERMISSION OF FDH VELOCITEL IS PROHIBITED FDH VELOCIT'EL PROJECT NUMBER 16PXJY2400 BEDDOR ENTERPRISES 878498 7700 QUATTRO CHANHASSEN, MN 55317 SHEET TITLE GENERAL NOTES SHEET NUMBER S-3 ti 0 '. - TOWER ELEVATION SCALE NTS MANUFACTURER POLE SPECIFICATIONS POLE SHAPE TYPE. 18-SIDED POLYGON 0.159254 IWFT ASTM A572 GRADE 65 A871-60 (60 KSI, 1 2 1,4"O ti16J ASTM A615 GRADE 75 TAPER. SHAFT STEEL- BASE PLATE STEEL. ANCHOR RODS. MANUFACTURER SHAFT SECTION DATA SHAFT SECTION SECTION LENGTH (FT) PLATE THICKNESS (IN) LAP SPLICE (IN) DIAMETER ACROSS FLATS (IN) @TOP @BOTTOM 1 224E 0.1875 35-03125 15.330 19.065 2 4746 0.25 18.204 26.000 NOTE-. DIMENSIONS SHOWN DO NOT INCLUDE GALVANIZING TOLERANCES TOWER MODIFICATION SCHEDULE NO. TYPE OF MODIFICATION BTM. ELEV. TOP ELEV. SHEET 1 INSTALLATION OF NEW MONOPOLE EXTENSION 67.0'x 87.0Y S-5 TO S-6 2 INSTALLATION OF NEW SAFETY CLIMB. TUF-TUG PAN TTCSCS 11-0'* 86.6't - • CONTRACTOR SHALL VERIFY ALL APPURTENANCE CONDITIONS AND DIMENSIONS IN RELATIONSHIP TO THIS MODIFICATION. APPURTENANCES MAY NEED TO BE TEMPORARILY REMOVED OR MOVED DURING THE INSTALLATION OF THIS MODIFICATION. CONTRACTOR SHALL IMMEDIATELY REPORT ANY AND ALL DISCREPANCIES TO THE FOR AND CROWN CASTLE PRIOR TO PROCEEDING WITH THE WORK. • ALL MODIFICATIONS TO BE INSTALLED CONTINUOUSLY THROUGH EXISTING EQUIPMENT. ALL EXISTING EQUIPMENT NOT TO BE DAMAGED OR TAKEN OFF AIR DURING INSTALLATION. • SEE STRUCTURAL ANALYSIS REPORT FOR EXISTING ANTENNA LOADING. • SHIMS FOR MONOPOLE REINFORCEMENT MEMBERS SHALL BE REQUIRED WHERE GAPS BETWEEN THE POLE SHAF- AND REINFORCING MEMBER EXIST AT FASTENER LOCATIONS. FOR INTERMEDIATE CONNECTIONS, THE MINIMUM SHIM LENGTH AND WIDTH SHALL BE THE WIDTH OF THE REINFORCING MEMBER FOR TERMINATION CONNECTIONS A CONTINUOUS SHIM PLATE IPREFERRED) OR EQUIVALENT INDIVIDUAL SHIM PLATES, MATCHING THE WIDTH OF THE REINFORCING MEMBER MAY BE USED SHIM THICKNESS SHALL BE NO LESS THAN 116'. STACKING OF SHIMS IS PERMITTED FINGER SHIMS AND HORSESHOE SHIMS ARE PERMITTED- STACKED SHIMS SHALL BE NO GREATER THAN 1 4" WITHOUT FOR APPROVAL. • FOR PLATES STARTING AT 6'. THE BOTTOM OF THE FLAT PLATE SHALL BEGIN AT 6" i 1". FOR SINGLE PLATES OR MULTIPLE PLATES SPLICED TOGETHER. THE BOTTOM OF THE FLAT PLATE RUN SHALL BEGIN AT THE PROPOSED ELEVATION 3 3'. FOR MULTIPLE PLATES SPLICED TOGETHER. THE TOP OF THE FLAT PLATE IS TO BE PLACED SUCH THAT THERE IS NO MORE THAN 3" DIFFERENCE BETWEEN THE ACTUAL OVERALL LENGTH OF THE SPAN AND THE PROPOSED OVERALL LENGTH OF THE SPAN, FROM THE BOTTOM OF THE BOTTOM PLATE TO THE TOP OF THE TOP PLATE • PRIOR TO FABRICATION AND INSTALLATION, CONTRACTOR SHALL FIELD VERIFY ALL LENGTHS AND QUANTITIES GIVEN. LENGTH AND QUANTITIES PROVIDED ARE FOR QUOTING PURPOSES ONLY, AND SHALL NOT BE USED FOR FABRICATION BASE LEVEL LAYOUT SCALE NTS (INSTALLED) (3) 1-1/4" TO 65 FT LEVEL J \ (PROPOSED) (2) 1-1,'2" TO 80 FT LEVEL VELDO=E ENGINEERING NOVATION PREPARED FOR CROWN CASTLE pgOFESSI LENCIN€EA I tweby cert this this plan, specification, or rep^rt wasp qt mved by me or under my direct SuoerVIsion that I am a duly I-icensed P mfesswa .g:neer urKder the :avr� of the Stele of M. Prwd µerne to Dennis Q. A 4el Slgraturc Date f &' l L licenser 41120 DENNIS D. ABEL. PE MINNESOTA UC. NO. 41120 DRAWN BY. WJD CHECKED BY. - S ENG APPV'D. DDA SUBMITTALS DATE DESCRIP7ION RE, 12n&16 CONSTRUCTION THE INFORMATION CONTAINED IN THIS SET OF DOCUMENTS IS PROPRIETARY BY NATURE REPRODUCTION OR CAUSING TO BE REPRODUCED THE WHOLE OR ANY PART OF THESE DRAWINGS WITHOUT THE PERMISSION OF FDH VELOCITEL IS PROHIBITED FDH VELOCITEL PROJECT NUMBER. 16PXJY2400 BEDDOR ENTERPRISES 878498 7700 QUATTRO CHANHASSEN, MN 55317 SHEET TITLE MODIFICATION SCHEDULE & BASE LEVEL LAYOUT SHEET NUMBER S-4 1 .- (3) NEW 1 118'0 FLANGE BOLTS - WITH NUTS & LOCK WASHERS ON A V-7'0 B.C. �\ r TOP OF EXTENSION S5 ELEV: 8T-0'± SLIP-1 - NEW SAFETY LINE PLATE. 5 SEE MATERIAL SCHEDULE ON SHEET S-6 FOR DETAILS. S-5 PE-1 NEW PIPE EXTENSION. SEE SHEET S-6 FOR DETAILS C.L. PORTHOLE � NEW STEP BOLT SEE - THIS SHEET FOR DETAILS (TYP r. i C.L. PORTHOLE ELEV: 77-11 1/2'* (12) NEW 1 118-0 FLANGE BOLTS - WITH NUTS & LOCK WASHERS ON A 1'-7"0 B.C. BTM. OF E�XTE�NSION o EXISTING MONOPOLE PE-1 NEW PIPE EXTENSION SEE SHEET S-6 FOR DETAILS NEW STEP BOLT. SEE SCHEDULE FOR DETAILS. \ (TYP) A PE-1 NEW PIPE EXTENSION. SEE SHEET S-6 FOR DETAILS. FP-1 NEW FLANGE PLATE. SEE ' SHEET S-6 FOR DETAILS i I I I I SLP-1 �IIJII � NEW SAFETY LINE PLATE. SEE MATERIAL SCHEDULE ON SHEET S-6 FOR DETAILS. STEP BOLT INSTALLATION SECTION VIEW 2 SECTION S-5 SCALE: NTS (12) NEW 1 1r8"0 FLANGE BOLTS O O WITH NUTS & LOCK WASHERS ON A 1'-7"0 B C. NEW STEP BOLT. SEE SCHEDULE FOR DETAILS. O(TYP.) PIPE EXTENSION LAYOUT SECTION VIEW 3 SECTION 1 S 5 / SCALE: NTS PE-1 NEW PIPE EXTENSION. SEE SHEET S-6 FOR DETAILS. / 12) NEW 518"0 HEX NUTS NEW 518*0 x 7" STEP BOLT S SBB-1 NEW STEP BOLT BRACKET. SEE SHEET S-6 FOR DETAILS. PIPE EXTENSION MATERIAL SCHEDULE PART QUANTITY DESCRIPTION PE-1 1 PIPE EXTENSION 15 1 118"0 A325N FLANGE BOLT W1 NUT & LOCK WASHERS - 18 518"0 x 7' STEP BOLT 36 518'0 HEX NUT TUF-TUG TTCSCS 1 SAFETY CLIMB SYSTEM • CONTRACTOR TO REPLACE SAFETY CLIMB CABLE. ONE CONTINUOUS CABLE IS REQUIRED FROM TOP OF EXTENSION TO BASE OF TOWER. SEE MATERIAL SCHEDULE FOR DETAILS. • INSTALL EXTENSION WITH STEP PEGS IN LINE WITH EXISTING STEP PEGS. • CONTRACTOR TO REMOVE AND REPLACE EXISTING LIGHTNING ROD. REPLACEMENT LIGHTNING ROD TO BE PLACED AT TOP OF EXTENSION. • CONTRACTOR TO PERFORM SITE VISIT PRIOR TO ORDERING MATERIALS TO VERIFY ANY INSTALLATION INTERFERENCES. PE-1 NEW PIPE EXTENSIr"' SEE Ski FOR DETA St NEW SAFETY LINE PLA SEE MATERIAL SCHEDULE SHEET S-6 FOR DETA w U In Z LU �~�Oa n W O�-1h- j LULL = `" DRILLED Op O HOLE IL (TYP-) 1 USE MIN. EDGE DISTANCE OF LS TIMES -T— - HOLE DIA (TYP ) PREPARED BY VELOCfTEL ENGINEERING INNOVATION PREPARED FOR CROWN CASTLE FROMSSIC L ENPIN�EA I hereby cert tha' this plan, specAcatlon, or report was p. mved by rr►e or under my direct supervision that I am a duty Licensed Profession girleer under the Laws ofthe State of Mir Print Nam- ota Dennis el Signature: , ` t.icense 41 120 Dime7i' DENNIS D ABEL. PE MINNESOTA LIC. NO. 41120 12 15 16 DRAWN BY. wJD CHECKED BY: KLS ENG APPVD DDA SUBMITTALS DATE DESCRIPTION REV 12,15116 CONSTRUCTION 0 THE INFORMATION CONTAINED IN THIS SET OF DOCUMENTS IS PROPRIETARY BY NATURE REPRODUCTION OR CAUSING TO BE REPRODUCED THE WHOLE OR ANY PART OF THESE DRAWINGS WITHOUT THE PERMISSION OF FDH VELOCREL IS PROHIBITED FOH VELOCITEL PROJECT NUMBER 16PXJY2400 BEDDOR ENTERPRISES 878498 _ 4uDRESS 7700 QUATTRO CHANHASSEN. MN 55317 SHEET TITLE PIPE EXTENSION INSTALLATION DETAILS I PIPE EXTENSION INSTALLATION STEP BOLT INSTALLATION SAFETY LINE PLATE DRILL DETAIL ELEVATION VIEW PLAN VIEW ELEVATION VIEW SHEET NUMBER ELEVATION a DETAIL 5 DETAIL S-5 -�—SCALE: NTS S-5 SCALE: NTS S 5 SCALE: NTS S-5 PH-1 NEW PORTHOLE W/ KELLUM HOOKS. SEE THIS SHEET FOR DETAILS. (TYP. ) (TYP ! \- - 5;1166 ---� 7/16 / -—1'-101/2' �{ — 20'-0" 7 SPACES 2'-6' = 1 T-6" { (TYP.) `- -- 1'-10 tit" - 7 1/2' ` SBB-1 P_1(TYP ) TYP. EACH END) _ 7 SPACES 2'-6" = 1 T-6' PIPE EXTENSION SIDE VIEW PE-1 DETAIL S-6 /. SCALE: NTS W vA i P-1 O 12 (TYP.) NEW SAFETY CLIMB. SEE SCHEDULE ON SHEET S-5 FOR DETAILS. PIPE EXTENSION INSTALLATION SECTION VIEW SECTION S 6 / SCALE: NTS PH-1 NEW SABRE PORTHOLE. SEE MATERIAL LIST. (2) NEW SABRE KELLUM HOOKS PER PORTHOLE. (INCLUDED IN PORTHOLE PIN C30-138-101) PEA IPE SION 1" (TYP-) PORTHOLE INSTALLATION LAYOUT SECTION VIEW z DETAIL S-6 SCALE: NTS (TYP.) \ PH -I (TYP �g1 > O O O O O O \ O O O 1 112' THICK PLATE (12) 1 3116.0 HOLES ON A V-7.0 B.C. FLANGE PLATE PLAN VIEW % FP-1 DETAIL \ S-6 / SCALE: NTS 3"—I-1/4' MATERIAL LIST (PE-1) PART # QTY. DESCRIPTION P_1 T P14xO.375 114.0" O.D.) x 19'-9' LONG FP-1 2 FLANGE PLATE CP-1 1 CAP PLATE SBB-1 18 STEP BOLT BRACKET SUP-1 1 SAFETY LINE PLATE (Pl. 1/2x6'x9') PH-1 6 PORTHOLE - SABRE PM C30-138-101 CP-1 1. CONTRACTOR TO FIELD VERIFY LOCATION OF PROPOSED EXTENSION PRIOR TO MATERIAL ORDERS AND FABRICATION. 2. ALL DIMENSIONS ARE PRELIMINARY UNTIL FIELD VERIFIED BY CONTRACTOR. ANY CHANGES MUST BE APPROVED BY ENGINEER OF RECORD IN WRITING PRIOR TO FABRICATION AND INSTALLATION. - - 1'-10' - VELOCfTEL ENGINEERING INNOVATION PREPARED FOR - CROWN CASTLE PROFMIC LENGINF-EA I hereoy ce t the• this plan, spe-cification. or report wasp urecl :Ty me or under my direct SUneMSIOn I I J that I arr a d,Jiy LCensed Pro!esslona .g neer under the :aws of the State of M ,r Pn11t N,,, Den iS) el Signature. IL Ucznse 41120 irate I L-r '2'5'E T" O -; .)(3ll I 1 I 11116'0 HOLE FOR 1 /4' THK. STEP BOLT �\ PLATE I 1/4' THICK 1• _�'.� c PLATE OLES � r ON A V-7'0 B.C. CAP PLATE PLAN VIEW DETAIL S 6 SCALE: NTS STEP BOLT BRACKET FRONT 81 TOP VIEW rBB� DETAIL S 6 SCALE: NTS DENNIS D. ABEL, PE MINNESOTA LIC. NO.41120 DRANK BY: WJD CHECKED BY: KLS I ENG APPVID- DDA I SUBMITTALS M DESCRIPTION RE' CONSTRUCTION 0 THE INFORMATION CONTAINED IN THIS SET OF 7000MENTS IS PROPRIETARY BY NATURE REPRODUCTION OR CAUSING TO BE REPRODUCED THE WHOLE OR ANY 'ART OF THESE DRAWWGS WITHOUT THE PERMISSION OF FDH VELOCREL 15 PROHIBITED FDH VELOCITEL PROJECT NUMBER - 16PXJY2400 SITE NAME BEDDOR ENTERPRISES 878498 7700 QUATTRO CHANHASSEN, MN 55317 SHEET TITLE PIPE EXTENSION INSTALLATION DETAILS II SHEET NUMBER S-6 CITY OF CHANHASSEN AFFIDAVIT OF MAILING NOTICE STATE OF MINNESOTA) ) ss. COUNTY OF CARVER ) I, Kim T. Meuwissen, being first duly sworn, on oath deposes that she is and was on January 4, 2018, the duly qualified and acting Deputy Clerk of the City of Chanhassen, Minnesota; that on said date she caused to be mailed a copy of the attached notice of hearing to consider an amendment to the Conditional Use Permit to expand a communication tower on property located at 7700 Quattro Drive and zoned Industrial Office Park District (IOP). Applicant: Crown Castle Services Owner: Marilyn Beddor. to the persons named on attached Exhibit "A", by enclosing a copy of said notice in an envelope addressed to such owner, and depositing the envelopes addressed to all such owners in the United States mail with postage fully prepaid thereon; that the names and addresses of such owners were those appearing as such by the records of the County Treasurer, Carver County, Minnesota, and by other appropriate records. Subs bed and sworn to before me this day of lanR 2018. ary Public r-- Kim 1. Meuwissen, Deputy olzk, JE iFER ANN POTTER Notary Public Minnesota ply Commissbn Expires Jan 31. 2= Notice of Public Hearing Chanhassen Planning Commission Meeting Notice of Public Hearing Chanhassen Planning Commission Meeting Date & Time: Tuesday, January 16, 2018 at 7:00 p.m. This hearing may not start until later in the evening, depending on the order of the agenda Location: City Hall Council Chambers, 7700 Market Blvd. Request to consider an amendment to the Conditional Use Proposal: Permit to expand a communication tower on property located at 7700 Quattro Drive and zoned Industrial Office Park District (lop). Applicant: Crown Castle Services Property 7700 Quattro Drive Location: A location map is on the reverse side of this notice. The purpose of this public hearing is to inform you about the applicant's request and to obtain input from the neighborhood about this project. During the meeting, the Chair will lead the What Happens public hearing through the following steps: at the Meeting: 1. Staff will give an overview of the proposed project. 2. The applicant will present plans on the project. 3. Comments are received from the public. 4. Public hearing is closed and the Commission discusses the project. If you want to see the plans before the meeting, please visit the City's projects web page at: www.ci.chanhassen.mn.us/2018-03. If you wish to talk to someone about this project, please contact Bob Generous by Questions & email at bgenerous(aDci.chanhassen.mn.us or by phone at Comments: 952-227-1131. If you choose to submit written comments, it is helpful to have one copy to the department in advance of the meeting. Staff will provide copies to the Commission. The staff report for this item will be available online on the project web site listed above the Thursday prior to the Planning Commission meeting. receive email and/or text notifications when meeting agendas, NEW! Sign up to packets, minutes and videos are uploaded to the city's website. Go to www.ci.chanhassen.mn.us/notifyme to sign up! City Review Procedure: • Subdivisions, Planned Unit Developments, Site Plan Reviews, Conditional and Interim Uses, Wetland Alterations. Rezonings, Comprehensive Plan Amendments and Code Amendments require a public hearing before the Planning Commission City ordinances require all property within 500 feet of the subject site to be notified of the application in writing Any interested party is invited to attend the meeting • Staff prepares a report on the subject application that includes all pertinent information and a recommendation These reports are available by request At the Planning Commission meeting, staff will give a verbal overview of the report and a recommendation The item will be opened for the public to speak about the proposal as a part of the hearing process The Commission will close the public hearing and discuss the item and make a recommendation to the City Council. The City Council may reverse, affirm or modify wholly or partly the Planning Commission's recommendation. Rezonings, land use and code amendments take a simple majority vote of the City Council except rezonings and land use amendments from residential to commercialhndustnal. • Minnesota State Statute 519 99 requires all applications to be processed within 60 days unless the applicant waives this standard Some applications due to their complexity may take several months to complete. Any person wishing to follow an item through the process should check with the Planning Department regarding its status and scheduling for the City Council meeting • A neighborhood spokesperson/representative is encouraged to provide a contact for the city Often developers are encouraged to meet with the neighborhood regarding their proposal. Staff is also available to review the project with any interested person(s) • Because the Planning Commission holds the public hearing, the City Council does not. Minutes are taken and any correspondence regarding the application will be included in the report to the City Council. If you wish to have something to be included in the report. lease contact the Planning Staff person named on the notification. Date & Time: Tuesday, January 16, 2018 at 7,00 p.m. This hearing may not s, until later in the evening, depending on the order of the agenda. Location: City Hall Council Chambers, 7700 Market Blvd. Request to consider an amendment to the Conditional Use Permit to expand a communication tower on property located Proposal: at 7700 Quattro Drive and zoned Industrial Office Park District IOP . Crown Castle Services Applicant: Property 7700 Quattro Drive Location: A location map is on the reverse side of this notice. The purpose of this public hearing is to inform you about the applicant's request and to obtain input from the neighborhood about this project. During the meeting, the Chair will lead the What Happens public hearing through the following steps: 1. Staff will give an overview of the proposed project. at the Meeting: 2. The applicant will present plans on the project. 3. Comments are received from the public. 4. Public hearing is closed and the Commission discusses the project. If you want to see the plans before the meeting, please visit the City's projects web page at: www.ci.chanhassen.mn.us/2018-03. If you wish to talk to someone about this project, please contact Bob Generous by Questions 8r email at bgenerous(aDci.chanhassen.mn.us or by phone at 952-227-1131. If you choose to submit written comments, it is Comments: helpful to have one copy to the department in advance of the meeting. Staff will provide copies to the Commission. The staff report for this item will be available online on the project web site listed above the Thursday prior to the Planning Commission meeting. NEW! Sign up to receive email and/or text notifications when meeting agendas, packets, minutes and videos are uploaded to the city's website. Go to www.ci.chanhassen.mn.us/notifyme to sign up! City Review Procedure: • Subdivisions, Planned Unit Developments, Site Plan Reviews, Conditional and Interim Uses, Wetland Alterations, Rezonings, Comprehensive Plan Amendments and Code Amendments require a public hearing before the Planning Commission. City ordinances require all property within 500 feet of the subject site to be notified of the application in writing. Any interested party is invited to attend the meeting. • Staff prepares a report on the subject application that includes all pertinent information and a recommendation. These reports are available by request. At the Planning Commission meeting, staff will give a verbal overview of the report and a recommendation. The item will be opened for the public to speak about the proposal as a part of the hearing process. The Commission will close the public hearing and discuss the item and make a recommendation to the City Council. The City Council may reverse, affirm or modify wholly or partly the Planning Commission's recommendation. Rezonings, land use and code amendments take a simple majority vote of the City Council except rezonings and land use amendments from residential to commercial/industrial . Minnesota State Statute 519.99 requires all applications to be processed within 60 days unless the applicant waives this standard. Some applications due to their complexity may take several months to complete Any person wishing to follow an item through the process should check with the Planning Department regarding its status and scheduling for the City Council meeting. . A neighborhood spokespersonlrepresentative is encouraged to provide a contact for the city Often developers are encouraged to meet with the neighborhood regarding their proposal. Staff is also available to review the project with any interested person(s). • Because the Planning Commission holds the public hearing, the City Council does not Minutes are taken and any correspondence regarding the application will be included in the report to the City Council . If you wish to have something to be included in the report, lease contact the Planning Staff person named on the notification. BEDDOR ENTERPRISES P 0 BOX 489 CHANHASSEN MN 55317 BANTA DIRECT MARKETING GROUP 300 LANG BLVD GRAND ISLAND NY 14072 MELISSA KATHLEEN FRANKLIN 18925 TWILIGHT TR EDEN PRAIRIE MN 55346 DELL ROAD PARTNERS LLP 8821 SUNSET TRAIL CHANHASSAN MN 55317 JED E & DARA 1 PERSSON 18847 TWILIGHT TR EDEN PRAIRIE MN 55346 RONALD CARLSON/TRACY JOHNSON 18821 TWILIGHT TR EDEN PRAIRIE MN 55346 STACEY A BICKLER 18711 TWILIGHT TR EDEN PRAIRIE MN 55346 HERMAN HOLDINGS ONE LLC 7660 QUATTRO DR CHANHASSEN MN 55317 DALE K & SUSAN P JACOBSON 18769 TWILIGHT TR EDEN PRAIRIE MN 55346 BEP/LYMAN LLC 1990 LARSEN RD GREEN BAY WI 54303-4803 ERIKA M LAKE 18795TWILIGHTTR EDEN PRAIRIE MN 55346 ALAN M KRETZSCHMAR 18679 TWI LIGHT TR EDEN PRAIRIE MN 55346 CUSTON FAB SOLUTIONS LLC 7600 QUATTRO DR CHANHASSEN MN 55317 TWIN CITIES & WESTERN RR CO 292512TH ST E GLENCOE MN 55336 JOHN E BENIK 18899 TWILIGHT TR EDEN PRAIRIE MN 55346 NICOLAOS GATSINOS 118873 TWILIGHT TR I EDEN PRAIRIE MN 55346 RANDY WEIGMAN 118743 TWILIGHT TR IEDEN PRAIRIE MN 55346 CITY OF CHANHASSEN RECEIVED Date: December 15, 2016 15 2U1/ Joshua Boots Crown Castle CHANHASSEN PLANNING DEPT 1500 Corporate Drive Canonsburg, PA 15317 Subject: Structural Modification Report Carrier Designation: Crown Castle Designation Engineering Firm Designation Site Data: Dear Joshua Boots, Verizon Wireless Co -Locate Carrier Site Name: e V ELDCITEL Velociter Inca �%.la v� Velocitel 6521 Meridien Drive Raleigh. North Carolina 27616 919.755.1012 Crown Castle BU Number: Crown Castle Site Name: Crown Castle JDE Job Number: Crown Castle Work Order Number: Crown Castle Application Number: FDH Velocitel Project Number: MACAROON 878498 BEDDOR ENTERPRISES 393859 1333733 359616 Rev.5 16PXJY2400 7700 Quattro. Chanhassen, Hennepin County, MN Latitude 44' 51' 53.39". Longitude -93' 30' 55.09" 87 Foot - Monopole Tower FDH Velocitel is pleased to submit this "Structural Modification Report" to determine the structural integrity of the above mentioned tower. This analysis has been performed in accordance with the Crown Castle Structural 'Statement of Work' and the terms of Crown Castle Purchase Order Number 977732. in accordance with application 359616. revision 5. The purpose of the analysis is to determine acceptability of the tower stress level. Based on our analysis we have determined the tower stress level for the structure and foundation, under the following load case, to be: LC4.5: Modified Structure wl Existing + Proposed Sufficient Capacity Note See Table I and Table II for the proposed and existing loading. respectively This analysis has been performed in accordance with the 2012 International Building Code based upon an ultimate 3-second gust wind speed of 115 mph converted to a nominal 3-second gust wind speed of 89 mph per section 1609.3.1 as required for use in the TIA-222-G Standard per Exception #5 of Section 1609.1.1. Exposure Category B with a topographic category 1 and crest height of 0 feet, and Risk Category II were used in this analysis. All modifications and equipment proposed in this report shall be installed in accordance with the attached drawings for the determined available structural capacity to be effective. We at FDH Velocitel appreciate the opportunity of providing our continuing professional services to you and Crown Castle. If you have any questions or need further assistance on this or any other projects please give us a call. Str ctural analysis prepared by Kelse argenT. EI Project Engineer I tnxTower Report - version 7.0.5.1 Reviewed by: f Dennis D. Abel. PE Director of Structural Engineering MN PE License No. 41120 PROFES51 LE1%lN9E8 1 hereby ce6ty that this plan, specification, or report was prepared by me or under my direct supervision and that I rim a duly Licensed Professional Engineer under the ;aws of the Stets of Minnesota Print !JameDennis D. Abel Signature: , 4=c -" Date /Z-l5-zlo16 License*_ 41 12Q 87 Ft Monopole Tower Structural Modification Analysis Project Number 16PXJY2400. Application 359616. Revision 5 TABLE OF CONTENTS 1) INTRODUCTION 2) ANALYSIS CRITERIA Table 1 - Proposed Antenna and Cable Information Table 2 - Existing Antenna and Cable Information Table 3 - Design Antenna and Cable Information 3) ANALYSIS PROCEDURE Table 4 - Documents Provided 3.1) Analysis Method 3.2) Assumptions 4) ANALYSIS RESULTS Table 5 - Section Capacity (Summary) Table 6 — Tower Components Stresses vs. Capacity 4.1) Recommendations 5) APPENDIX A tnxTower Output 6) APPENDIX B Base Level Drawing 7) APPENDIX C Additional Calculations 8) APPENDIX D Modification Drawings December 15. 2016 CC/ BU No 878498 Page 2 tnxTower Report - version 7.0.5.1 n I 87 Ft Monopole Tower Structural Modification Analysis Project Number 16PXJY2400. Application 359616, Revision 5 1) INTRODUCTION December 15. 2016 CCI BU No 878498 Page 3 This tower is a 67 ft Monopole tower designed by ENGINEERED ENDEAVORS. INC. in July of 1996. The tower was originally designed for a wind speed of 95 mph per TIA/EIA-222-E. The modifications listed in FDH Velocitel (Project No. 16PXJY2400) Extension Drawings for a 67' Monopole dated December 15. 2016 were considered in this analysis. 2) ANALYSIS CRITERIA The structural analysis was performed for this tower in accordance with the requirements of TIA-222-G Structural Standards for Antenna Supporting Structures and Antennas using a 3-second gust wind speed of 89 mph with no ice. 50 mph with 0.75 inch ice thickness and 60 mph under service loads, exposure category B with topographic category 1 and crest height of 0 feet. Table 1 - Proposed Antenna and Cable Information Center Number Number Feed Mounting Line of Antenna Antenna Model of Feed Line Note Level (ft) Elevation Antennas Manufacturer Lines Size (in) 3 3 3 80.0 80.0 3 12 i 2 1 ericsson RRUS 12 B5/RRUS A2 RRUS 32 B2 RRUS 32 B66 RRUS B13/RRUS A2 2 1-1 2 X7CQAP-86-865-V RXXDC-3315-PF-48 Platform Mount [LP 301-11 ericsson ericsson ericsson jma wireless raycap crown mounts Table 2 - Existing Antenna and Cable Information Center Number Number Feed Mounting Line of Antenna Antenna Model of Feed Line Note Level (ft) Elevation Antennas Manufacturer Lines Size (in) (ft) 660 65.0 65.0 3 kmw Comm ET-X-W M 18-65-8P 3 kmw Comm ET-X-TS-70-16-62-18-iR- RD 3 samsung telecom Power Junction Cylinder Optic Fiber Junction Cylinder 3 samsung telecom 3 samsung telecom 2.5 GHz RRH-V3 3 samsung telecom RRH-P4 3 samsung telecom RRH-C2A w/ Ext Filter 1 1 tower mounts T-Arm Mount [TA 602-31 Notes: 1) Existing Equipment Table 3 - Design Antenna and Cable Information 3 Center Number Number Feed Mounting Line of Antenna Antenna Model of Feed Line Size Level (ft) Elevation Antennas Manufacturer Lines (in) (ft) 85.0 l 85.0 9 , Scala AP17-1900/090D 9 - 65.0 65.0 12 Scala AP17-1900/090D 12 45.0 45.0 9 Scala AP 1 7-1900/090D 9 tnxTower Report - version 7.0.5.1 0 87 Ft Monopole Tower Structural Modification Analysis Project Number 16PXJY2400. Application 359616. Revision 5 3) ANALYSIS PROCEDURE Table 4 - Documents Provided December 15. 2016 CCI BU No 878498 Page 4 Document Remarks Reference Source I 4-GEOTECHNICAL REPORTS 4-TOWER FOUNDATION DRAWINGS/DESIGN/SPECS 4-TOWER FOUNDATION DRAW INGS/DESIGN/SPECS 4-TOWER MANUFACTURER DRAWINGS 4-TOWER REINFORCEMENT DESIGN/DRAW INGS/DATA 3.1) Analysis Method TERRACON ENGINEERING ENDEAVORS INCORPORATED ENGINEERING ENDEAVORS INCORPORATED ENGINEERING ENDEAVORS INCORPORATED FDH Velocitel 1557642 CCISITES 1479249 CCISITES 1480353 CCISITES 2197969 CCISITES Project No. I Appendix D 16PXJY2400 tnxTower (version 7.0.5.1), a commercially available analysis software package, was used to create a three-dimensional model of the tower and calculate member stresses for various loading cases. Selected output from the analysis is included in Appendix A. 3.2) Assumptions 1) Tower and structures were built in accordance with the manufacturer's specifications. 2) The tower and structures have been maintained in accordance with the manufacturer's specification. 3) The configuration of antennas. transmission cables. mounts and other appurtenances are as specified in Tables 1 and 2 and the referenced drawings. 4) The modifications listed in FDH Velocitel (Project No. 16PXJY2400) Extension Drawings for a 67.0' Monopole dated December 15. 2016 must be completed in order for this analysis to be considered valid. This analysis may be affected if any assumptions are not valid or have been made in error. FDH Velocitel should be notified to determine the effect on the structural integrity of the tower. 4) ANALYSIS RESULTS Table 5 - Section Capacity (Summarv) Section Elevation (ft) Component Size Critical P (K) SF'P_allow % Pass I Fail No. Type Element (K) Capacity L7 L2 i 87 - 67 Pole TP14xl4x0.375 67 - 44.5391 Pole TP19.0645xl5.33x0.1875 44.5391 - 0 Pole TP26x18.2041 x0.25 1 -4.42 Wb.63 4 i 1 i rass 813.18 84 2 Pass 1506.86 1 89.1 Pass 2 -7.52 L3 3 -12.29 Summary Pole (1-3) 89.1 Pass Rating = 89.1 Pass tnxTower Report - version 7.0.5.1 87 Ft Monopole Tower Structural Modification Analysis Project Number 16PXJY2400. Application 359616. Revision 5 1 1 1 j Flange Bolts 1 67.0 Flange Plate 67.0 Anchor Rods 0 Base Plate 0 Base Foundation Base Foundation Soil Interaction 0 0 29.0 28.8 49.2 94.4 61.2 K -1 December 15, 2016 CC/ BU No 878498 Page 5 Pass Pass Pass Pass Pass Pass Structure Rating (max from all components) = I 94.4% Notes: 1) See additional documentation in 'Appendix C — Additional Calculations" for calculations supporting the °o capacity consumed. 4.1) Recommendations The tower and its foundation have sufficient capacity to carry the existing and proposed loads once the modifications outlined in FDH Velocitel (Project No. 16PXJY2400) Extension Drawings for a 67.0' Monopole dated December 15, 2016 are completed. tnxTower Report - version 7.0.5.1 87 Ft Monopole Tower Structural Modification Analysis Project Number 16PXJY2400. Application 359616. Revision 5 APPENDIX A TNXTOWER OUTPUT December 15, 2016 CCI BU No 878498 Page 6 tnxTower Report - version 7.0.5.1 11 DESIGNED APPURTENANCE LOADING TYPE ELEVATION I TYPE ELEVATION L9br9 Rod 31r x r 87 ET-X-W M-186&8P wl Mount Pipe 65 - - 87.0 R 14) X7COAP-86-865-V - _ 80 ET-X-WM-1865-BP wl Mount Pice - _ - 65 _ A)X7CCAP-86$6SV 80 ET-X-WM-1865-8P wI Mawl Pipe 65 (4) X70OAP-66-865-V 80 OPTIC FIBER JUNCTION CYLINDER 65 RRUS 32 B2 80 _ _OPTIC FIBER JUNCTION CYLINDER 65 - __-- RRUS 32 82 80 _OPTIC FIBER JUNCTION CYLINDER 65 _ RRUS 32 82 80 POWER JUNCTION CYLINDER 65 M'- RRUS 32 OW so POWER JUNCTION CYLINDER 65 3 c RRUS 32 B66 80 POWER JUNCTION CYLINDER - —_ -RRH-C2A 65 RRUS 32 B66 80WEXT FILTER 65 — — RRUS 12 t35lRRl1S A2 80 �RRH-C2A wIEXT FILTER - -65 - RRUS 12 B51RRUS A2 - 80 - - RRH-C2A w1EXT FILTER 65 RRUS 12 B5RRUS A2 80 RR1+P4 65 RRUS BIN RUSA2 116 RRIW4 65 RRUS 813RRUS A2 80 RRH-P4 _65 _ RRUS813RRUSA2 80 2.5GMz RRH-V3 65 (2) RXXDC-3315-PF48 80 — 2.5GHz RRH-V3 65 - - - m 67.0 ft - PWtIorm Moats [LP 301-11 80 2.5GHz RRH-V3 65 Mncelaneous INA 509-31 80 6 x 2" Mount Pipe 65 < ET-X-TS-70-1662-1842-RD w/ Marts 65 6 x 2- Mare Pipe 65 _ P.Pe 6 x 2' Moult Pipe 65 ET-X-TS-70-1662-18-iR-RDw1M0rts �65-- T-Arm Mount ITA 602-31 65 Pipe ET-X-TS-70-16-62-184R-RD wl Mou t 65 Pipe m — a m MATERIAL STRENGTH GRADE Fy Fu GRADE Fy F. A53.8-35 35 ksi 63 ksi A57265 65 ks. 80 kS, TOWER DESIGN NOTES 1. Tower is located in Hennepin County, Minnesota. 2. Tower designed for Exposure B to the TIA-222-G Standard. 3. Tower designed for a 89 mph basic wind in accordance with the TIA-222-G Standard. 4. Tower is also designed for a 50 mph basic wind with 0.75 in ice. Ice is considered to 44.5 ft increase in thickness with height. 5. Deflections are based upon a 60 mph wind. 6. Tower Structure Class It. 7. Topographic Category 1 with Crest Height of 0.00 ft 8. TOWER RATING: 89.1% a a a c m g ALL REACTIONS ARE FACTORED AXIAL 26 K SHEAR MOMENT 3 K J 250 kip-ft TORQUE 0 kip-ft 50 mph WIND - 0.7500 in ICE AXIAL 12K SHEAR MOMENT 10 K J T 703 kip-ft ooft TORQUE 1 kip-ft a — — REACTIONS - 89 mph WIND 0 5 • i' ¢ = 9 m' d 3 FDH Velocitel BUS 878498, Beddor Enterprises 6521 Meridien Drive, Suite 107 P qp 16PXJY2400 - • Raleigh, North Carolina 27616 c"1t Crown Castle Dr'"n°t` Kelsey Sargent AWd Tp w awys s Phone: 9197551012 cod` TIA-222-G Da"' 12/15/16 $Ce"': NTS FAX 9197S51031 Pal" ___- _ - __- _D`-N&E-1. Tower Input Data There is a pole section. This tower is designed using the TIA-222-G standard The following design criteria apply: Tower is located in Hennepin County, Minnesota. ASCE 7-10 Wind Data is used (wind speeds converted to nominal values). Basic wind speed of 89 mph. Structure Class II. Exposure Category B. Topographic Category 1. Crest Height 0.00 ft. Nominal ice thickness of 0.7500 in. Ice thickness is considered to increase with height. Ice density of 56 pcf. A wind speed of 50 mph is used in combination with ice. Temperature drop of 50 'F. Deflections calculated using a wind speed of 60 mph. A non -linear (P-delta) analysis was used. Pressures are calculated at each section. Stress ratio used in pole design is 1. Local bending stresses due to climbing loads, feed line supports, and appurtenance mounts are not considered. Consider Moments - Legs Consider Moments - Horizontals Consider Moments - Diagonals Use Moment Magnification Use Code Stress Ratios Use Code Safety Factors - Guys Escalate Ice Always Use Max Kz Use Special Wind Profile Include Bolts In Member Capacity Leg Bolts Are At Top Of Section Secondary Horizontal Braces Leg Use Diamond Inner Bracing (4 Sided) SR Members Have Cut Ends SR Members Are Concentric Options Distribute Leg Loads As Uniform Assume Legs Pinned Assume Rigid Index Plate N Use Clear Spans For Wind Area Use Clear Spans For KL'r Retension Guys To Initial Tension N Bypass Mast Stability Checks Use Azimuth Dish Coefficients Project Wind Area of Appurt. Autocak Torque Arm Areas Add BC .6D—W Combination Sort Capacity Reports By Component Triangulate Diamond Inner Bracing Treat Feed Line Bundles As Cylinder Use ASCE 10 X-Brace Ly Rules Calculate Redundant Bracing Forces Ignore Redundant Members in FEA SR Leg Bolts Resist Compression All Leg Panels Have Same Allowable Offset Girt At Foundation Consider Feed Line Torque Include Angle Block Shear Check Use TIA-222-G Bracing Resist. Exemption Use TIA-222-G Tension Splice Exemption Pelee Include Shear -Torsion Interaction Always Use Sub -Critical Flow Use Top Mounted Sockets Tapered Pole Section Geometry Section Elevation Section Splice Number Top Bottom Wall Bend Pole Grade Length Length of Diameter Diameter Thickness Radius jt (t t Sides in in in in Ll 87.00-67.00 20.00 0.00 Round 14.0000 14.0000 0.3750 A53-13-35 (35 ksi) L2 67.00-44.54 22.46 2.92 18 15.3300 19.0645 0.1875 0.7500 A572-65 (65 ksi) L3 44.54-0.00 47.46 18 18,2041 26.0000 0.2500 1.0000 A572-65 (65 ksi) Tapered Pole Properties Section Tip Dia. Area I r C I/C J IdQ w w/t in inz in in in in3 in in in Ll 14.0000 16.0516 372.7602 4.8190 7.0000 53.2515 745.5204 8.0210 0.0000 0 14.0000 16.0516 372.7602 4.8190 7.0000 53.2515 745.5204 8.0210 0.0000 0 L2 15.5665 9.0117 261.0588 5.3756 7.7876 33.5222 522.4612 4.5067 2.3681 12.63 19.3586 11.2342 505.7601 6.7013 9.6948 52.2222 1012.1857 5.6182 3.0254 16.135 L3 18.9719 14.2466 580.1990 6.3737 9.2477 62.7399 1161.1614 7.1247 2.7639 11.056 26.4011 20.4326 1711.6544 9.1412 13.2080 129.5922 3425.5610 10.2183 4.1360 16.544 Tower Gusset Gusset Gusset Grade Adjust. Factor Adjust. Weight Mult. Double Angle Double Angle Double Angle Elevation Area Thickness At Factor Stitch Bolt Stitch Bolt Stitch Bolt (perface) A, Spacing Spacing Spacing Diagonals Horizontals Redundants ft jt in in in in L 1 87.00-67.00 1 I L2 67.00-44,54 1 1 l L3 44.54-0.00 1 1 Feed Line/Linear Appurtenances - Entered As Round Or Flat Description Sector Component Placement Total .Number Start/End Width or PerimeicWeight Type .Number Per Row Position Diameter ft in in plf HIr9612XXX(1-1/2") B SurfaceAr 80.00-0.00 2 2 0.400 1.4930 1.87 (CaAa) 0.500 Feed Line/Linear Appurtenances - Entered As Area Description Face Allow Component Place", Total CAAA Weight or Shield Type Number Leg Jt Aft pl TYPE 5(1-1 4") B No Inside Pole 65.00 - 0.00 3 No Ice 0.00 1.10 1 2" Ice 0.00 1.10 I" Ice 0.00 1.10 Feed Line/Linear Appurtenances Section Areas Tower Tower Face AN 1; CAAA C,AA Weight Section Elevation In Face Out Face ft !ta ft' ft, ft' K Ll 87.00-67.00 A 0.000 0.000 0.000 0.000 0.00 B 0.000 0.000 3.882 0.000 0.05 C 0.000 0.000 0.000 0.000 0.00 L2 67.00-44.54 A 0.000 0.000 0.000 0.000 0.00 B 0.000 0.000 6.707 0.000 0.15 C 0.000 0.000 0.000 0.000 0.00 L3 44.54-0.00 A 0.000 0.000 0.000 0.000 0.00 B 0.000 0.000 13.299 0.000 0.31 C 0.000 0.000 0.000 0.000 0.00 Feed Line/Linear Appurtenances Section Areas -With Ice Tower Tower Face Ice AR Af CAA CiAA Weight Section Elevation or Thickness In Face Out Face ft Leg in ftz ftt ft, ft' K Ll 87.00-67.00 A 1.633 0.000 0.000 0.000 0.000 0.00 B 0.000 0.000 10.158 0.000 0.16 C 0.000 0.000 0.000 0.000 0.00 L2 67.00-44.54 A 1.580 0.000 0.000 0.000 0.000 0.00 u Tower Tower Face Ice An At CAA CtAA Weight Section Elevation or Thiclrness In Face Out Face fr Leg in f? ft` fr ft1 K _ B 0.000 0.000 17.254 0.000 0.33 C 0.000 0.000 0.000 0.000 0.00 L3 44.54-0.00 A 1.435 0.000 0.000 0.000 0.000 0.00 B 0.000 0.000 34.213 0.000 0.67 C 0.000 0.000 0.000 0.000 0.00 Feed Line Center of Pressure CPz CPx CPz Section Elevation CPx ke Ice ft in in in in LI 87.00-67.00 0.2523 0.1124 0.3851 0.1715 L2 67.00-44.54 0.3634 0.1618 0.5344 0.2379 L3 44.54-0.00 0.3713 0.1653 0.5968 0.2657 Shielding Factor Ka Tower Feed Line Description Feed Line ll . Section Record No. Se nt Elev. ti'o Icc Ice Ll 1 HL-9612XXX(1-1/2") 67.00-80.00 1.0000 1.0000 L2 I HL-%12XXX(1-12") 44.54-67.00 1.0000 1.0000 Discrete Tower Loads Azimuth Plu Weight CAAA CtAA Description Face Offset Offsets: or Twee Horz Adjustment Front Side Leg Lateral Vert ft ft ft' ft, K h It Lighting Rod 3/4" x 7' C From Leg 0.00 0.0000 87.00 No Ice 0.53 0.53 0.03 0.00 1/2" Ice 114 1.24 0.04 s.. 3.50 1" Ice 1.97 1.97 0.05 (4) X7CQAP-86-865-V A From Leg 4.00 0.0000 80.00 No Ice 13.44 7.81 0.05 0.00 1/2" Ice 14.04 8.40 0.13 0.00 P Ice 14.65 9.00 0.21 (4) X7CQAP-86-865-V B From Leg 4.00 0.0000 80.00 No Ice 13.44 7.81 0.05 0.00 1/2" Ice 14.04 8.40 0.13 0.00 P Ice 14.65 9.00 0.21 (4) X7CQAP-86-865-V C From Leg 4.00 0.0000 80.00 No Ice 13.44 7.81 0.05 0.00 1 /2" Ice 14.04 8.40 0.13 0.00 1" Ice 14.65 9.00 0.21 RRUS 32 B2 A From Leg 4.00 0.0000 80.00 No Ice 2.76 1.69 0.05 0.00 1/2" Ice 2.98 1.88 0.07 0.00 1" Ice 3.22 2.07 0.10 RRUS 32 B2 B From Leg 4.00 0.0000 80.00 No Ice 2.76 1.69 0.05 0.00 1/2" Ice 2.98 1.88 0.07 0.00 1" Ice 3.22 2.07 0.10 RRUS 32 B2 C From Leg 4.00 0.0000 80.00 No Ice 2.76 1.69 0.05 0.00 1/2" Ice 2.98 1.88 0.07 0.00 I" Ice 3.22 2.07 0.10 RRUS 32 B66 A From Leg 4.00 0.0000 80.00 No Ice 2.74 1.67 0.05 Description Face Offset Offsets: Azimuth Placement C,AA CAAA Weight or Ttipe Horz Adjustment Front Side Leg Lateral Vert h h i, to K ft t 0.00 1, 2" Ice 2.96 1.86 0.07 0.00 l" Ice 3.19 2.05 0.10 RRUS 32 B66 C From Leg 4.00 0.0000 80.00 No Ice 2.74 1.67 0.05 0.00 12" Ice 2.% 1.86 0.07 0.00 l" Ice 3.19 2.05 0.10 RRUS 32 B66 C From Leg 4.00 0.0000 80.00 No Ice 2.74 1.67 0.05 0.00 1 /2" Ice 2.96 1.86 0.07 0.00 l" Ice 3.19 2.05 0.10 RRUS 12 B5%RRUS A` A From Leg 4.00 0.0000 80.00 No Ice 3.15 1.85 0.08 0.00 l '2" Ice 3.36 2.03 0.11 0.00 1" Ice 3.59 2.21 0.14 RRUS 12 B5/RRUS A2 B From Leg 4.00 0.0000 80.00 No Ice 3.15 1.85 0.08 0.00 1 /2" Ice 3.36 2.03 0.11 0.00 1" Ice 3.59 2.21 0.14 RRUS 12 B5/RRUS A2 C From Leg 4.00 0.0000 80.00 No Ice 3.15 1.85 0.08 0.00 1/2" Ice 3.36 2.03 0.11 0.00 l" Ice 3.59 2.21 0.14 RRUS B13/RRUS A2 A From Leg 4.00 0.0000 80.00 No Ice 2.79 1.74 0.07 0.00 1/2" Ice 3.00 1.91 0.10 0.00 t" Ice 3.21 2.09 0.13 RRUS B13/RRUS A2 B From Leg 4.00 0.0000 80.00 No Ice 2.79 1.74 0.07 0.00 12" Ice 3.00 1.91 0.10 0.00 I" Ice 3.21 2.09 0.13 RRUS B13/RRUS A2 C From Leg 4.00 0.0000 80.00 No Ice 2.79 1.74 0.07 0.00 17Ice 3.00 1.91 0.10 0.00 1" Ice 3.21 2.09 0.13 (2) RXXDC-3315-PF48 A From Leg 4.00 0.0000 80.00 No Ice 3.36 2.19 0.03 0.00 lit" Ice 3.60 2.39 0.06 0.00 1" Ice 3.84 2.61 0.09 Platform Mount [LP 301-1] C None 0.0000 80.00 No Ice 30.10 30.10 1.59 1 2" Ice 40.80 40.80 2.03 1" Ice 51.50 51.50 2.47 Miscellaneous [NA 509-31 C None 0.0000 80.00 No Ice 11.84 11.94 0.28 12" Ice 16.% 16.% 0.30 sss 1" Ice 22.08 22.08 0.32 ET-X-TS-70-16-62-18-iR-RD A From Leg 4.00 0.0000 65.00 No Ice 8.50 6.49 0.07 w/ Mount Pipe 0.00 1, 2" Ice 9.07 7.69 0.13 1.00 1" Ice 9.61 8.62 Oil ET-X-TS-70-16-62-18-iR-RD B From Leg 4.00 0.0000 65.00 No Ice 8.50 6.49 0.07 wi Mount Pipe 0.00 12" Ice 9.07 7.69 0.13 1.00 1" Ice 9.61 8.62 0.21 ET-X-TS-70-16-62-18-iR-RD C From Leg 4.00 0.0000 65.00 No Ice 8.50 6.49 0.07 wi Mount Pipe 0.00 1/2" Ice 9.07 7.69 0.13 1.00 1" Ice 9.61 8.62 0.21 ET-X-WM-18-65-8P w/ A From Leg 4.00 0.0000 65.00 No Ice 6.92 4.43 0.06 Mount Pipe 0.00 t/2" Ice 7.40 5.32 0.11 1.00 1" Ice 7.87 6.08 0.17 ET-X-WM-18-65-8P w' B From Leg 4.00 0.0000 65.00 No Ice 6.92 4.43 0.06 Mount Pipe 0.00 I2" Ice 7.40 532 0.11 1.00 1" Ice 7.87 6.08 0.17 ET-X-WM-18-65-8P w/ C From Leg 4.00 0.0000 65.00 No Ice 6.92 4.43 0.06 Mount Pipe 0.00 I/2" Ice 7.40 5.32 0.11 1.00 1" Ice 7.87 6.08 0.17 OPTIC FIBER JUNCTION A From Leg 4.00 0.0000 65.00 No Ice 0.39 0.39 0.00 CYLINDER 0.00 1Z' Ice 0.48 0.48 0.01 0.00 1" Ice 0.57 0.57 0.01 OPTIC FIBER JUNCTION B From Leg 4.00 0.0000 65.00 No Ice 0.39 0.39 0.00 CYLINDER 0.00 I!2" Ice 0.48 0.48 0.01 0.00 1" Ice 0.57 0.57 0.01 OPTIC FIBER JUNCTION C From Leg 4.00 0.0000 65.00 No Ice 0.39 0.39 0.00 CYLINDER 0.00 1 2" Ice 0.48 0.48 0.01 0.00 1" Ice 0.57 0.57 0.01 POWER JUNCTION A From Leg 4.00 0.0000 65.00 No Ice 0.37 0.37 0.00 CYLINDER 0.00 1 2" Ice 0.45 0.45 0.01 0.00 I" Ice 0.55 0.55 0.01 POWER JUNCTION B From Leg 4.00 0.0000 65.00 No Ice 0.37 0.37 0.00 Description Face Offset Offsets: Azimuth Placement C,AA CAAA Weight or Tvpe Harz Adjustment Front Side Leg Lateral Vert ft ji f� fit' x h CYLINDER 0.00 1. 2" Ice 0.45 0.45 0.01 0.00 1" Ice 0.55 0.55 0.01 POWER JLNCTION C From Leg 4.00 0.0000 65.00 No Ice 0.37 0.37 0.00 CYLINDER 0.00 12" Ice 0.45 0.45 0.01 0.00 l" Ice 0.55 0.55 0.01 RRH-C2A w EXT FILTER A From Leg 4.00 0.0000 65.00 No Ice 3.1 I 1.38 0.06 0.00 l /2" Ice 3.33 1.55 0.08 0.00 l" Ice 3.56 1.72 0.10 RRH-C2A w; EXT FILTER B From Leg 4.00 0.0000 65.00 No Ice 3.11 1.38 0.06 0.00 l 2" Ice 3.33 1.55 0.08 0.00 1" Ice 3.56 1.72 0.10 RRH-C2A w/EXT FILTER C From Leg 4.00 0.0000 65.00 No Ice 3.11 1.38 0.06 0.00 1/2" Ice 3.33 1.55 0.08 0.00 l" Ice 3.56 1.72 0.10 RRH-P4 A From Leg 4.00 0.0000 65.00 No Ice 2.74 1.79 0.06 0.00 1 2" Ice 2.95 1.97 0.08 0.00 1" Ice 3.17 2.16 0.11 RRH-P4 B From Leg 4.00 0.0000 65.00 No Ice 2.74 1.79 0.06 0.00 1/2" Ice 2.95 1.97 0.08 0.00 l" Ice 3.17 2.16 0.11 RRH-P4 C From Leg 4.00 0.0000 65.00 No Ice 2.74 1.79 0.06 0.00 12" Ice 2.95 1.97 0.08 0.00 V Ice 3.17 2.16 0.11 2.5GHz RRH-V3 A From Leg 4.00 0.0000 65.00 No Ice 2.40 1.22 0.06 0.00 1'2" Ice 2.60 1.36 0.08 0.00 1" Ice 2.80 1.51 0.10 2.5GHz RRH-V3 B From Leg 4.00 0.0000 65.00 No Ice 2.40 1.22 0.06 0.00 1 2" Ice 2.60 1.36 0.08 0.00 1" Ice 2.80 1.51 0.10 2.5GHz RRH-V3 C From Leg 4.00 0.0000 65.00 No Ice 2.40 1.22 0.06 0.00 1 2" Ice 2.60 1.36 0.08 0.00 1" Ice 2.80 1.51 0.10 6' x 2" Mount Pipe A From Leg 4.00 0.0000 65.00 No Ice 1.43 1.43 0.02 0.00 1 2" Ice 1.92 1.92 0.03 0.00 l" Ice 2.29 2.29 0.05 6' x 2" Mount Pipe B From Leg 4.00 0.0000 65.00 No Ice 1.43 1.43 0.02 0.00 1.2" Ice 1.92 1.92 0.03 0.00 1" Ice 2.29 2.29 0.05 6' x 2" Mount Pipe C From Leg 4.00 0.0000 65.00 No Ice 1.43 1.43 0.02 0.00 112" Ice 1.92 1.92 0.03 0.00 1" Ice 2.29 2.29 0.05 T-Arm Mount [TA 602-3] C None 0.0000 65.00 No Ice 11.59 11.59 0.77 1 2" Ice 15.44 15.44 0.99 1" Ice 19.29 19.29 1.21 Load Combinations Comb. Description No. 1 Dead Only 2 1.2 Dead+ 1.6 Wind 0 deg - No Ice 3 0.9 Dead+1.6 Wind 0 deg - No Ice 4 1.2 Dead+1.6 Wind 30 deg - No Ice 5 0.9 Dead+ 1.6 Wind 30 deg - No Ice 6 1.2 Dead+1.6 Wind 60 deg - No Ice 7 0.9 Dead+ 1.6 Wind 60 deg - No Ice 8 1.2 Dead+1.6 Wind 90 deg - No Ice 9 0.9 Dead+1.6 Wind 90 deg - No Ice 10 1.2 Dead+1.6 Wind 120 deg - No Ice 11 0.9 Dead+ 1.6 Wind 120 deg - No Ice 12 1.2 Dead+l .6 Wind 150 deg - No Ice Comb. Description ,Va. 13 0.9 Dead+1.6 Wind 150 deg - No Ice 14 1.2 Dead+1.6 Wind 180 deg - No Ice 15 0.9 Dead+1.6 Wind 180 deg - No Ice 16 1.2 Dead+1.6 Rind 210 deg - No Ice 17 0.9 Dead+1.6 Wind 210 deg - No Ice 18 1.2 Dead+1.6 Wind 240 deg - No Ice 19 0.9 Dead+1.6 Wind 240 deg - No Ice 20 1.2 Dead+1.6 Wind 270 deg - No Ice 21 0.9 Dead+1.6 Wind 270 deg - No Ice 22 1.2 Dead+1.6 Wind 300 deg - No Ice 23 0.9 Dead+1.6 Rind 300 deg - No Ice 24 11 Dead+1.6 Wind 330 deg - No Ice 25 0.9 Dead+1.6 Wind 330 deg - No Ice 26 1.2 Dead+1.0 Ice+1.0 Temp 27 1.2 Dead+1.0 Wind 0 deg+1.0 Ice+1.0 Temp 28 1.2 Dead+1.0 Wind 30 deg-1.0 Ice+1.0 Temp 29 1.2 Dead+1.0 Wind 60 deg-I.0 Ice+1.0 Temp 30 1.2 Dead+1.0 Wind 90 deg-1.0 Ice+1.0 Temp 31 1.2 Dead+1.0 Wind 120 deg+1.0 Ice-1.0 Temp 32 1.2 Dead+1.0 Wind 150 deg+1.0 Ice-1.0 Temp 33 1.2 Dead+1.0 Wind 180 deg+1.0 Ice-I.0 Temp 34 1.2 Dead+1.0 Wind 210 deg+1.0 Ice+1.0 Temp 35 1.2 Dead+1.0 Wind 240 deg+1.0 Ice-1.0 Temp 36 1.2 Dead+1.0 Wind 270 deg+1.0 Ice- 1.0 Temp 37 1.2 Dead+1.0 Wind 300 deg+1.0 Ice-1.0 Temp 38 1.2 Dead+1.0 Wind 330 deg+1.0 Ice-1.0 Temp 39 Dead+Wind 0 deg - Service 40 Dead+Wind 30 deg - Service 41 Dead+Wind 60 deg - Service 42 Dead+Wind 90 deg - Service 43 Dead+Wind 120 deg - Service 44 Dead+Wind 150 deg - Service 45 Dead+W'ind 180 deg - Service 46 Dead+Wind 210 deg - Service 47 Dead+Wind 240 deg - Service 48 Dead+Wind 270 deg - Service 49 Dead+Wind 300 deg - Service 50 Dead+Wind 330 deg - Service Maximum Member Forces Section Elevation Component Condition Gov. Axial .Major Axis .Minor Axis ,Va. ft Type Load .Moment Moment Comb. K kip-ft kip-ft L 1 87 - 67 Pole Max Tension 26 0.00 -0.00 -0.00 Max. Compression 26 -12.40 1.20 1.53 Max. Mx 20 4.43 83.67 -0.08 Max. My 2 4.42 0.10 84.41 Max. Vy 20 -6.51 83.67 -0.08 Max. Vx 2 -6.58 0.10 84.41 Max. Torque 18 -0.74 L2 67 - 44.5391 Pole Max Tension 1 0.00 0.00 0.00 Max. Compression 26 -19.40 1.16 1.65 Max. Mx 20 -7.54 253.34 -0.57 Max. My 2 -7.52 -0.43 255.49 Max. Vy 20 -9.02 253.34 -0.57 Max. Vx 2 -9.09 -0.43 255.49 Max. Torque 18 -0.74 L3 44.5391 - 0 Pole Max Tension 1 0.00 0.00 0.00 Max. Compression 26 -25.78 0.71 1.55 Max. Mx 20 -12.29 697.07 -1.81 Max. My 2 -12.29 -1.78 702.55 Max. Vy 20 -9.63 697.07 -1.81 Max. Vx 2 -9.70 -1.78 702.55 Max. Torque 18 -0.73 Maximum Reactions Location Condition Gov. Vertuai Load K Comb. Pole Max. Vert 27 25.78 Max. H. 21 914 Max. H, 3 914 Max. M� 2 702.55 Max. M, 8 6%.57 Max. Torsion 6 0.73 Min. Vert 7 914 Min. H. 8 12.32 Min. H, 15 9.24 Min. M. 14 -702.10 Min. M, 20 -697.07 Min. Torsion 18 -0.73 Horizontal, X Horizontal, Z K K -0.01 3.15 9.60 -0.02 -0.02 9.67 -0.02 9.67 -9.60 0.02 -8.33 4.85 -8.33 4.85 -9.60 0.02 0.02 -9.67 0.02 -9.67 9.60 -0.02 8.33 -4.85 Tower Mast Reaction Summary Load Vertical Shear, Shear_. Overturning Overturning Torque Combination Moment, Af, Moment, M, K K K kip ft kip ft kip ft Dead Only 10.26 -0.00 -0.00 -0.18 0.20 -0.00 1.2 Dead-1.6 Wind 0 deg - No 12.32 0.02 -9.67 -702.55 -1.78 -0.41 Ice 0.9 Dead- 1.6 Wind 0 deg - No 9.24 0.02 -9.67 -688.55 -1.81 -0.39 Ice 1.2 Dead -1.6 Wind 30 deg - No 12.32 4.82 -8.38 -609.46 -349.89 -0.65 Ice 0.9 Dead -1.6 Wind 30 deg - No 9.24 4.82 -8.38 -597.31 -343.01 -0.63 Ice 1.2 Dead-1.6 Wind 60 deg - No 12.32 8.33 -4.85 -353.14 -604.20 -0.73 Ice 0.9 Dead-1.6 Wind 60 deg - No 9.24 833 -4.95 -346.07 -592.28 -0.71 Ice 1.2 Dead -1.6 Wind 90 deg - No 12.32 9.60 -0.02 -2.24 -696.57 -0.60 Ice 0.9 Dead -1.6 Wind 90 deg - No 9.24 9.60 -0.02 -2.13 -682.81 -0.59 Ice 1.2 Dead-1.6 Wind 120 deg - 12.32 8-31 4.81 349.22 -602.20 -0.32 No Ice 0.9 Dead -1.6 Wind 120 deg - 9.24 8.31 4.81 342.35 -590.32 -0.32 No Ice 1.2 Dead - 1.6 Wind 150 deg - 12.32 4.78 8,36 607.02 -346.39 0.05 No Ice 0.9 Dead-1.6 Wind 150 deg - 9.24 4.78 8.36 595.03 -339.59 0.04 No Ice 1.2 Dead-1.6 Wind I80 deg - 12.32 -0.02 9.67 702.10 2.27 0.41 No Ice 0.9 Dead-1.6 Wind 180 deg - 9.24 -0.02 9.67 688.22 2.16 0.39 No Ice 1.2 Dead- 1.6 Wind 210 deg - 12.32 4.82 8.38 609.02 350.38 0.65 No Ice 0.9 Dead-1.6 Wind 210 deg - 9.24 4.82 8.38 5%.99 343.36 0.63 No Ice 1.2 Dead-1.6 Wind 240 deg - 12.32 -8.33 4.85 352.72 604.69 0.73 No Ice 0.9 Dead- 1.6 Wind 240 deg - 9.24 -8.33 4.85 345.77 592.63 0.71 No Ice 1.2 Dead-1.6 Wind 270 deg - 12.32 -9.60 0.02 1.81 697.07 0.60 No Ice 0.9 Dead-1.6 Wind 270 deg - 9.24 -9.60 0.02 1.83 683.17 0.59 No Ice 1.2 Dead - L6 Wind 300 deg - 12.32 -8.31 4.81 -349.66 602.71 0.32 No Ice 0.9 Dead-1.6 Wind 300 deg - 9.24 -8.31 4.81 -342.66 590.68 0.32 No Ice 1.2 Dead-1.6 Wind 330 deg - 12.32 4.78 -8.36 -607.47 346.90 -0.05 Load Vertical Shear, Shear, Overturning Overturning Torque Combination Moment, M, Moment, M_ K K K kip-ft kw-ft kip -It No Ice 0.9 Dead-1.6 Wind 330 deg - 9.24 -4.78 -8.36 -595.35 339.95 -0.04 No Ice 1.2 Dead- 1.0 Ice- 1.0 Temp 25.78 -0.00 -0.00 -1.55 0.71 -0.00 1.2 Dead-1.0 Wind 0 deg-1.0 25.78 0.01 -3.15 -250.07 0.21 -0.17 Ice+1.0 Temp 1.2. Dead-1.0 Wind 30 deg+1.0 25.78 1.57 -2.73 -217.03 -123.28 -0.25 Ice+1.0 Temp 1.2 Dead-1.0 Wind 60 deg+1.0 25.78 2.72 -1.58 -12616 -213.55 -0.27 Ice+1.0 Temp 1.2 Dead-1.0 Wind 90 deg+1.0 25.78 3.14 -0.01 -2.08 -246.41 -0,22 Ice+1.0 Temp 1.2 Dead-l.0 Wind 120 25.78 2.72 1.57 122.24 -213.05 -0.11 deg-1.0 Ice-1.0 Temp 1.2 Dead-1.0 Wind 150 25.78 1.56 2.73 213.38 -122.41 0.03 deg-1.0 Ice-1.0 Temp 1.2 Dead-1.0 Wind 180 25.78 -0.01 3.15 246.92 1.22 0.17 deg-1.0 ice-1.0 Temp 1.2 Dead-1.0 Wind 210 25.78 -1.57 2.73 213.88 124.72 0.25 deg-1.0 Ice-LO Temp 1.2 Dead-1.0 Wind 240 25.78 -2.72 1_58 123.11 214.99 0.27 deg-1.0 Ice-1.0 Temp 1.2 Dead-1.0 Wind 270 25.78 -3.14 0.01 -1.07 247.84 0.22 deg-1.0 Ice-1.0 Temp 1.2 Dead-1.0 Wind 300 25.78 -2.72 -1.57 -125.39 214.49 0.11 deg-1.0 Ice-1.0 Temp 1.2 Dead-1.0 Wind 330 25.78 -1.56 -2.73 -216.53 123.85 -0.03 deg-1.0 Ice-1.0 Temp Dead -Wind 0 deg - Service 10.26 0.01 -2.46 -177.03 -0.30 -0.10 Dead -Wind 30 deg - Service 10.26 1.23 -2.13 -153.59 -87.96 -0.17 Dead -Wind 60 deg - Service 10.26 2.12 -1.23 -89.05 -151.99 -0.19 Dead -Wind 90 deg - Service 10.26 2.44 -0.01 -0.69 -175.24 -0.16 Dead -Wind 120 deg - Service 10.26 2.11 112 87.80 -151.48 -0.08 Dead -wind 150 deg - Service 10.26 112 2.13 152.71 -87.07 0.01 Dead -Wind 180 deg - Service 10.26 -0.01 2.46 176.66 0.72 0.10 Dead -Wind 210 deg - Service 10.26 -1.23 2.13 153.22 88.37 0.17 Dead -Wind 240 deg - Service 10.26 -2.12 1.23 88.68 152.40 0.19 Dead -Wind 270 deg - Service 10.26 -2.44 0.01 0.32 175.65 0.16 Dead -Wind 300 deg - Service 10.26 -2.11 -1.22 -88.17 151.90 0.08 Dead -Wind 330 deg - Service 10.26 -1.22 -2.13 -153.08 87.49 -0.01 Solution Summary Sum ojApphed Forces 1um ojReactions Load PX PY PL PX PY PZ %Error Comb. K K K K K K 1 0.00 -10.26 0.00 0.00 10.26 0.00 0.000' o 2 0.02 -12.32 -9.67 -0.02 12.32 9.67 0.00010 3 0.02 -9.24 -9.67 -0.02 9.24 9.67 0.000' o 4 4.82 -12.32 -8.38 4.82 12.32 8.38 0.00000 5 4.82 -9.24 -8.38 4.82 9.24 8.38 0.000' o 6 8.33 -12.32 4.85 -8.33 12.32 4.85 0.000'. 7 8.33 -9.24 4.85 -8.33 9.24 4.85 0.000' 0 8 9.60 -12.32 -0.02 -9.60 12.32 0.02 0.000' o 9 9.60 -9.24 -0.02 -9.60 914 0.02 0.000' o 10 8.31 -12.32 4.81 -8.31 12.32 -4.81 0.000'0 11 8.31 -9.24 4.81 -8.31 9.24 -4.81 0.0001. 12 4.78 -12.32 8.36 4.78 12.32 -8.36 0.000'0 13 4.78 -9.24 8.36 4.78 9.24 -8.36 0.0001. 14 -0.02 -12.32 9.67 0.02 12.32 -9.67 0.00000 15 -0.02 -9.24 9.67 0.02 9.24 -9.67 0.000% 16 4.82 -12.32 8.38 4.82 12.32 -8.38 0.000% 17 4.82 -9.24 8.38 4.82 9.24 -8.38 0,000% 18 -8.33 -12.32 4.85 8.33 12.32 4.85 0.0009/0 19 -8.33 -9.24 4.85 8.33 9.24 4.85 0.0000/0 20 -9.60 -12.32 0.02 9.60 12.32 -0.02 0.0006/8 21 -9.60 -9.24 0.02 9.60 9.24 -0.02 0.0000/0 22 -8.31 -12.32 4.81 8.31 12.32 4.81 0.0000/0 Sum of Applied Forces Swn of Reactions Load PX PY PZ PX PY PZ % Error Comb. K K K K K K 23 -8.31 -9.24 4.81 8.31 9.24 4.81 0.000° u 24 4.78 -12.32 -8.36 4.78 12.32 8.36 0.00000 25 4.78 -9.24 -8.36 4.78 9.24 8.36 0.0000 0 26 0.00 -25.78 0.00 0.00 25.78 0.00 0.000o 0 27 0.01 -25.78 -3.15 -0.01 25.78 3.15 0.00000 28 1.57 -25.78 -2.73 -1.57 25.78 2.73 0.000% 29 2.72 -25.78 -1.58 -2.72 25.78 1.58 0.000% 30 3.14 -25.78 -0.01 -3.14 25.78 0.01 0.000% 31 2.72 -25.78 1.57 -2.72 25.78 -1.57 0.000°% 32 1.56 -25.78 2.73 -1.56 25.78 -2.73 0.000oo 33 -0.01 -25.78 3.15 0.01 25.78 -3.15 0.0001. 34 -1.57 -25.78 2.73 1.57 25.78 -2.73 0.0000o 35 -2.72 -25.78 1.58 2.72 25.78 -1.58 0.000o0 36 -3.14 -25.78 0.01 3.14 25.78 -0.01 0.00000 37 -2.72 -25.78 -1.57 2.72 25.78 1.57 0.00000 38 -1.56 -25.78 -2.73 1.56 25.78 2.73 0.00000 39 0.01 -10.26 -2.46 -0.01 10.26 2.46 0.000o0 40 1.23 -10.26 -2.13 -1.23 10.26 2.13 0.000°0 41 2.12 -1026 -1.23 -2.12 10.26 1.23 0.0000/0 42 2.44 -10.26 -0.01 -2.44 10.26 0.01 0.0000/0 43 2.11 -10.26 1.22 -2.11 10.26 -1.22 0.0000/0 44 1.22 -10.26 2.13 -1.22 10.26 -2.13 0.000% 45 -0.01 -10.26 2.46 0.01 10.26 -2.46 0.000% 46 -1.23 -10.26 2.13 123 10.26 -2.13 0.000% 47 -2.12 -10.26 1.23 2.12 10.26 -1.23 0.000% 48 -2.44 -10.26 0.01 2.44 10.26 -0.01 0.000% 49 -2.11 -10.26 -1_22 2.11 10.26 1.22 0.0000/0 50 -1.22 -10.26 -2.13 122 10.26 2.13 0.0000/0 Non -Linear Convergence Results Load Converged? .Number Displacement Force Combination of Cycles Tolerance Tolerance 1 Yes 4 0.00000001 0.00000001 2 Yes 6 0.00000001 0.00011436 3 Yes 5 0.00000001 0.00056600 4 Yes 7 0.00000001 0.00026502 5 Yes 6 0.00000001 0.00093445 6 Yes 7 0.00000001 0.00029071 7 Yes 7 0.00000001 0.00005%5 8 Yes 6 0.00000001 0.00023819 9 Yes 6 0.00000001 0.00007439 10 Yes 7 0.00000001 0.00026819 11 Yes 6 0.00000001 0.00094884 12 Yes 7 0.00000001 0.00027379 13 Yes 6 0.00000001 0.00097095 14 Yes 6 0.00000001 0.00017374 15 Yes 5 0.00000001 0.00086354 16 Yes 7 0.00000001 0.00029014 17 Yes 7 0.00000001 0.00005941 18 Yes 7 0.00000001 0.00026407 19 Yes 6 0.00000001 0.00093042 20 Yes 6 0.00000001 0.00017926 21 Yes 5 0.00000001 0.00092713 22 Yes 7 0.00000001 0.00028279 23 Yes 7 0.00000001 0.00005790 24 Yes 7 0.00000001 0.00027753 25 Yes 6 0.00000001 0.00098150 26 Yes 4 0.00000001 0.00035694 27 Yes 7 0.00000001 0.00027744 28 Yes 8 0.00000001 0.00024255 29 Yes 8 0.00000001 0.00026897 30 Yes 7 0.00000001 0.00029050 31 Yes 8 0.00000001 0.00023188 32 Yes 8 0.00000001 0.00023618 33 Yes 7 0.00000001 0.00027376 34 Yes 8 0.00000001 0.00026390 35 Yes 8 0.00000001 0.00023694 36 Yes 7 0.00000001 0.00029097 37 Yes 8 0.00000001 0.00026720 38 Yes 8 0.00000001 0.00026355 39 Yes 5 0.00000001 0.00012768 40 Yes 5 0.00000001 0.00089733 41 Yes 6 0.00000001 0.00008940 42 Yes 5 0.00000001 0.00020251 43 Yes 5 0.00000001 0.00090137 44 Yes 5 0.00000001 0.00094522 45 Yes 5 0.00000001 0.00014073 46 Yes 6 0.00000001 0.00008922 47 Yes 5 0.00000001 0.00089528 48 Yes 5 0.00000001 0.00019038 49 Yes 6 0.00000001 0.00008363 50 Yes 5 0.00000001 0.00099294 Maximum Tower Deflections - Service Wind Section Elevation Horz. Gov. Tilt Twist .Va. Deflection Load t in Comb. c o Ll 87 - 67 24.060 39 2.2240 0.0092 L2 67 - 44.5391 14.848 39 2.1158 0.0069 L3 47.4583 - 0 7.398 39 1.4727 0.0031 Critical Deflections and Radius of Curvature - Service Wind Elevation Appurtenance Tilt Twist Radius of Gov. Deflection Load Curvature ft Comb. in h 87.00 Lighting Rod 3 4" x 7' 39 24.060 2.2240 0.0092 13087 80.00 (4) X7CQAP-86-865-V 39 20.761 2.2309 0.0085 9347 65.00 ET-X-TS-70-16-62-18-iR-RD w 39 13.983 2.0717 0.0065 2799 Mount Pipe Maximum Tower Deflections - Design Wind Section Elevation Horz. Gov. T& Twist No. Deflection Load _ h in Comb. ° L1 87 - 67 95.308 2 8.8236 0.0361 L2 67 - 44.5391 58.882 2 8.4004 0.0271 L3 47.4583 - 0 29.368 2 5.8521 0.0123 Elevation Critical Deflections and Radius of Curvature - Design Wind Appurtenance Gov. Deflection Load Comb. in Tilt Twist Radius of Curvature 87.00 Lighting Rod 3/4" x 7' 2 95.308 8.8236 0.0361 3491 80.00 (4) X7CQAP-86-865-V 2 82.267 8.8532 0.0336 2493 65.00 ET-X-TS-70-16-62-18-iR-RD w/ 2 55.460 8.2257 0.0258 738 '.Mount Pipe Compression Checks Pole Design Data Section Elevation Sire L L. KI r A P. OP Ratio No, P. LI 87-67(1) TP14x14x0.375 20.00 L2 67-44.5391 TP19.0645xI5.33x0.1875 22.46 (2) L3 44.5391 - 0 (3) TP26xl8.2041 x0.25 47.46 ft in1 K K *P, 0.00 0.0 16.0516 4.42 505.63 0.009 0.00 0.0 10.9453 -7.52 813.18 0.009 0.00 0.0 20.4326 -12.29 1506.86 0.008 Pole Bending Design Data Section Elevation Size M Of., Ratio M. 1)y_. Ratio No. M- AL ft IAP ft kip -fit +M k P-ft kip-ft aM„ Ll 87 - 67 (l) TP14xl4x0375 84.41 182.79 0.462 0.00 182.79 0.000 L2 67-44.5391 TPI9.0645x15.330.1875 255.49 306.83 0.833 0.00 306.83 0.000 (2) L3 44.5391 - 0 (3) TP26x18.2041 x025 702.76 796.43 0.882 0.00 796.43 0.000 Pole Shear Design Data Section Elevation Size Actual 4V Ratio Actual jT Ratio No. V. V. T. T. h K K 4V kip ft kip-ft +T. L 1 87 - 67 (1) TP14xl4x0.375 6.58 252.81 0.026 0.41 279.57 0.001 L2 67-44.5391 TPI9.0645x15.33x0.1875 9.09 406.59 0.022 0.41 614.41 0.001 (2) L3 44.5391 - 0 (3) TP26xl8.2041 x0.25 9.70 753.43 0.013 0.65 1594.80 0.000 Pole Interaction Design Data Section Elevation Ratio Ratio Ratio Ratio Ratio Comb. Allow. Criteria 1Vo. P, Af Mn. V. T. Stress Stress ft �pl Of. 4m, oy 0T Ratio Ratio Ll 87 - 67 (1) 0.009 0.462 0.000 0.026 0.001 0.471 1.000 4 8 2 L2 67 - 44.5391 0.009 0.833 0.000 0.022 0.001 0.842 1.000 (2) 4 8 2 L3 44.5391 - 0 (3) 0.008 0.882 0.000 0.013 0.000 0.891 1.000 4.8.2 Section Capacity Table Section Elevation Component size Critical P ePd' % Pass NO. ft Type Element K K Capacity Fail Ll 87 - 67 Pole TP14xl4x0.375 1 -4.42 505.63 47.1 Pass L2 67 - 44.5391 Pole TP19.0645xl5.33x0.1875 2 -7.52 813.18 84.2 Pass L3 44.5391 -0 Pole TP26x18.204lx0.25 3 -12.29 1506.86 89.1 Pass Summary Pole (1-3) 89.1 Pass RATING = 39.1 Pass Program Version 7.0.5.1 - 2. 1 '2016 File:, ifdh-server. Projects-2016 Effective - Client JobsICROWNC_Crown Castle USA InciNWi878498_Beddor Enterprises.16PXJY2400-MODMOO_VZW R.0;Analysis/PassingTower/878498_Beddor Enterprises.en 87 Ft Monopole Tower Structural Modification Analysis Project Number 16PXJY2400. Application 359616, Revision APPENDIX B BASE LEVEL DRAWING December 15, 2016 CC/ BU No 878498 Page 7 tnxTower Report - version 7.0.5.1 J t0 S p O � 2 rf iV i 87 Ft Monopole Tower Structural Modification Analysis Project Number 16PXJY2400. Application 359616. Revision APPENDIX C ADDITIONAL CALCULATIONS December 15, 2016 CCI BU No 878498 Page 8 tnxTower Report - version 7.0.5.1 FC�H � • Monopole Slip Splice Length FDHV Project No.. 16PXJY2400 Site Name Beddor Enterprises Site ID/BU: 878498 Date 12/15/2016 Section Range Req. Splice length (ft) Act. Splice Length (ft) Top Section Base 0 (in) Section Scenario Top Elevation (ft) Bottom Elevation (ft) Section Results Definitions:Scenario A No stress reduction and no additional capacity evaluation for the slip splice is required. Reduction in effective yield stress for the slip splice per ANSI/TIA-222-G Section 13.3.5. B Capacity evaluation for the slip splice is required. Reinforcement of the slip splice is required. C The shaft cannot be considered effective and therefore the reinforcement must take 100% oftheload. Notes: 1. This sheet applies only to monopoles being analyzed under ANSI/TIA-222-G. 2. The capacities computed in this sheet supersede both tnx and CCIPole. 3. This sheet is currently set up to handle one size of flat plate monopole reinforcement. 4. Make sure to fill out "Section Mods?" in order to display proper capacity. S. If "N/A" Is displayed, it means there is an existing flange connection at that elevation. Stiffened or Unstiffened, Exterior Flange Plate - Any Bolt Material TIA Rev G Site Data BU# 878498 Site Name Beddor Enterprises App #: Pole Manufacturer: Other Bolt Data Qty: Diameter (in.): Bolt Material: NiA: N/A: Circle (in.: 12 Bolt Fu Bolt Fy <-- Disregard <— Disregard 1.125 A325 100 75 19 Plate Data Diam: Thick, t: Grade (Fy): Strength. Fu: Single -Rod B-eff: 22 in in ksi ksi in 1.5 36 58 3.67 Stiffener Data (Welding at Both Sides Config: Weld Type: Groove Depth: Groove Angle: Fillet H. Weld: Fillet V. Weld: Width: Height. Thick: Notch: Grade Weld str.: 0 <-- Disregard <-- Disregard in in in in in in ksi ksi Pole Data Diam: Thick: Grade # of Sides: Fu Reinf. Fillet Weld 14 in in ksi '0" IF Round ksi "0" if None 0.375 35 0 63 0 Reactions Mu Axial_ Pu: Shear. Vu: 84.41 ft-kips kips kips 4.42 6.58 Elevation: 67 feet Bolt Threads: X-Excluded (pVn=(p(0.55'Ab'Fu ) =0.75. (p'Vn (kips) 43.05 If No stiffeners, Criteria: I TIA G],-Only Applcable to Unstiffened Cases Flange Bolt Results Rigid Bolt Tension Capacity. (p'Tn,B1: 60.09 kips cp'Tn Ad usted (p'Tn (due to Vu=Vu/Qty), B: 60.08 kips (pTn[(1-tvu/(pvn1^2]10.5 105 Max Bolt directly applied Tu: 17.40 Kips 81 Min. PL "tc" for B cap. w/o Pry: 1.559 in Min PL "treg" for actual T w/ Pry: 0.648 in Min PL "tl" for actual T w/o Pry: 0.839 in T allowable with Prying: 57.91 kips 05a'51 case Prying Force. q: 0.00 kips Total Bolt Tension=Tu+q: 17.40 kips Prying Bolt Stress Ratio=(Tu+q)/(B): 29.0% Pass Exterior Flange Plate Results Flexural Check Compression Side Plate Stress: 9.3 ksi Allowable Plate Stress: 32.4 ksi Compression Plate Stress Ratio: 28.8% Pass No Prying Tension Side Stress Ratio. (treq/tl^2: 18.7% Pass n/a Stiffener Results Horizontal Weld n/a Vertical Weld: n/a Plate Flex+Shear. fb Fb+(fv/Fv)^2 n/a Plate Tension+Shear. ft/Ft+(fv/Fv(^2: n/a Plate Comp. (AISC Bracket): n/a Pole Results Pole Punching Shear Check n/a 0 = none. 1 = every bolt 2 = every 2 looks. 3 = 2 per bolt Note. for complete joint penetration groove welds the groove depth must be exactly 12 the stiffener thickness for calculation purposes Rigid TIA G cp'Fy Comp. Y.L. Length 12.85 CClplate v2.0 Analysis Date: 12/15/2016 Stiffened or Unstiffened, Ungrouted, Circular Base Plate - Any Rod Material TIA Rev G Assumption: Clear space between bottom of leveling nut and top of concrete not exceeding (1)'(Rod Diameter) Site Data BU#: 878498 Site Name: Beddor Enterprises App #: Pole Manufacturer Other 71 Anchor Rod Data Qty: Diam: Rod Material: Strength (Fu): Yield (Fy): Bolt Circle: 8 n ksi ksi in 2.25 A615-J 100 75 34 Plate Data Diam Thick: Grade: Single -Rod B-eff: 40 in in ksi in 1.5 60 10.32 Stiffener Data 'Welding at both sides) Config. Weld Type: Groove Depth: Groove Angle: Fillet H. Weld: Fillet V. Weld: Width: Height: Thick: Notch: Grade: Weld str.: 0 — Disregard — Disregard in in in in in in ksi ksi Pole Data Diam: Thick: Grade: # of Sides: Fu Reinf. Fillet weld 26 in in ksi "0' IF Round ksi "0" if None 0.25 65 18 80 0 Reactions Mu. 703 ft-kips Axial. Pu. 12 kips Shear, Vu. 10 ki s Eta Factor. rl 0.5 TIA G (Fi . 4 4 If No stiffeners. Criteria: I AISC LRFD <-Only Applcable to Unstiffened Cases Anchor Rod Results Max Rod (Cu+ Vu/rj): 128.0 Kips Allowable Axial, 4)`Fu'Anet: 260.0 Kips Anchor Rod Stress Ratio: 49.2% Pass Base Plate Results Flexural Check Base Plate Stress. 51.0 ksi Allowable Plate Stress: 54.0 ksi Base Plate Stress Ratio: 94.4% Pass n/a Stiffener Results Horizontal Weld: n/a Vertical Weld: n/a Plate Flex+Shear, fb/Fb+(fv/Fv)A2: n/a Plate Tension+Shear, f /Ft+(fv/Fv)A2: n/a Plate Comp. (AISC Bracket): n/a Pole Resuitts Pole Punching Shear Check: � - c 0 = none. 1 = every bolt, 2 = every 2 botts, 3 = 2 per bolt " Note: for complete joint penetration groove welds the groove depth must be exactly 1 /2 the stiffener thickness for calculation purposes n/a r on-Ri id ISC LRFD cp'Tn Non -Rigid AISC LRFD (p'Fy Y.L. Length 21.91 CClplate v2.0 Analysis Date: 12/15/2016 6"x12"x 5/8"x3-1/2" Sabre P/N C30-138-001 Area: 22.1866 Perimeter: 95.3198 Bounding box: X: 74.5411 -- 89.5411 Y:-3.8641 -- 12.9923 Centroid: X:81.5411 Y: 4.5641 Moments of inertia: X: 983.3482 Y:148038.7125 Product of inertia: XY: 8256.9745 Radii of gyration: X: 6.6575 Y: 81.6850 Principal moments and X-Y directions about centroid: I: 521.1819 along [1.0000 0.0000] J: 521.1819 along [0.0000 1.00001 Sx= 521.1819/8 = 64.2 in13 REGIONS Area: 16.0516 Perimeter: 85.6084 Bounding box: X: 30.4644 -- 44.4644 Y:-1.7829 -- 12.2171 Centroid: X:37.4644 Y: 5.2171 Moments of inertia: X: 809.6619 Y: 22902.5020 Product of inertia: XY: 3137.4005 Radii of gyration: X: 7.1022 Y: 37.7731 Principal moments and X-Y directions about centroid: I: 372.7602 along [1.0000 0.0000] J: 372.7602 along [0.0000 1.0000] Sx= 372.7602/7=53.3 inA3 CCi Foundation Tool Suite - Monopole Pier CCIFTS 1.LUM.14286 - phase 1.2 Bu: 879498 Site Name: Beddor Enterprises App Number: — - Work Order: Monopole Drilled Pier Input Criteria TIA Revision: ACI 318 Revision: Seismic Category: Forces Compression Shear Moment Swelling Force Foundation Dimensions Pier Diameter. Extabove grade: Depth below grade: Material Properties Number of Rebar Rebar Size: Tie Size Rebar tensile strength: Concrete Strength-. Ultimate Concrete Strain Clear Cover to Ties: Soil Profile: Beddor Soil G 2008 A 12 kips 10 kips 703 k-ft 0 kips S ft 1ft 22 ft 14 8 5 60 ksi 4000 psi 0.003 in/in 4 in Date: 12/15/2016 CCCROWN CASTLE Ultimate Ultimate Ultimate Friction Uplift Skin Comp. Skin Bearing Thickness From To Unit Weight Cohesion Angle Friction Friction Capacity SPT'N' Layer (ft) (ft) (it) (pcf) (psf) (deg) (ksf) (ksf) (ksf) Counts 1 6-667 0 6.667 120 0 0 0 0 0 2 6.333 6.667 13 120 1000 0.2 02 0 3 9 13 22 130 1700 0.35 ^,35 IJ Analysis Results Concrete/Steel Check Soil Lateral Capacity Mu (from soil analysis) 794.70 k-ft Depth to Zero Shear: 7.54 ft cliMn 1298.95 k-ft Max Moment, Mu: 794.70 k-ft RATING: 61.2% Soil Safety Factor: 3.50 Safety Factor Req'd: 1.33 RATING: 38.0% rho provided 0.39 rho required 0.33 OK Soil Axial Capacity Skin Friction (k): 52.03 kips Rebar Spacing 10.16 End Bearing (k): 154.63 kips Spacing required 16.00 OK Comp. Capacity (k), ¢Cn: 206.66 kips Comp. (k), Cu: 12.00 kips RATING: S.8% Dev Length required 14 13 Dev. Length provided 3795 OK Overall Foundation Rating: 61.27, Page 1 of 1 87 Ft Monopole Tower Structural Modification Analysis Project Number 16PXJY2400. Application 359616. Revision 5 APPENDIX D MODIFICATION DRAWINGS December 15, 2016 CCI BU No 878498 Page 9 tnxTower Report - version 7.0.5.1 PROJECT DESCRIPTION: EXTENSION DRAWINGS FOR A 67' MONOPOLE CROWN CASTLE ATTENTION ALL CONTRACTORS, ANYTIME YOU ACCESS A CROWN SITE FOR ANY REASON YOU ARE TO CALL THE CROWN NOC UPON ARRIVAL AND DEPARTURE, DAILY AT 000.788.7011. UUALIFIEO ENGINEERING SERVICES ARE AVAILABLE FROM FDH VELOCITEL TO ASSIST CONTRACTORS IN CLASS IV RIGGING PLAN REVIEWS. TO REQUEST QUALIFIED ENGINEERING SERVICES, PLEASE CONTACT FDH VELOCITEL AT RIGGINGCFDHVELOCITEL.COM OR,9191755.1012 PROJECT DATA CODES AND STANDARDS tllle.GNl.l1'.I AM. NI]WItkNAIIONAL tllI1,iI,I.I.. IIA tlIAN)ANU ANSUIM21]I. A IIMAI L WINU S'-U WI I NUUI ICL (—J 11} — NI. NAL WYRJ SYLLU WITH IM (—) !0 SLIIVII:L V WLLU I"M) tl0 k:L INA:NNL9Y MI U /'v FXD WAF WiFUDRY k uTRIICTURF G ASwrtwrxJk n TOMJIJIN —WTFW Y uRf Si likYlT IrT1 "IUI UFO t, un uo]F PROJECT CONTACTS CG YROJr CT NNNUFk NAME IMEn POIA EtrE CCI YROACT MANAGER FMNI M)UkFSS JANLU INNLL'ItFiI%NOWNW5ILl.CGA CCIDRO]FCT MANAOFR 4NONF NIRIIFR IJr� �IIUMF CG CLWSTRUCTIIRI MANAUPn INMP l;lW) NO TIER CCICONSTI I, IP I. Ierm.;i .Fb FNnu .Wlio1 , Fa11VaLOCdeI rRO.NCT eNoerelR NAW i dM. He lNf L,iLrtx�V.M"AS*I f e ro: MLWY MRaERT, FI rok veLacmLYRo]ecr eNOWnR eMAa AooRFu ReLeFY.eARoeYTpFarveLoclTeLcoM IOk Va —L YRU.NCT .-.KKR 1NOR9 RUMaeR IFIe)1f41et! 511E NAME. BEDDOR ENTERPRISES SITE NUMBER: 878498 SITE ADDRESS 7700 QUATTRO CHANHASSEN, MN 55317 L.00RDINATES. LAT: 44.8648' LONG:-93.5153' PASSING STRUCTURAL ANALYSIS SIkIA:I IAM1 ANAlYS15 COM✓ANY 1:NIAYN LMI LL ✓kWlCI NO 1]W]e0 W IL NIwf1.MFR 16. XItS WONIL ONOLW I]W ]W CCI p(%;Y WFA51 / PASSING STRUCTURAL ANALYSIS I MODIFICATION DRAWINGS SI WIC IVRK AIMLYaee COLVAM r U11 VLLIICIILI FraalLcl rp. 1aur�wu DAIL ULLAMYLN le, A116 alp YrplR oFvLw r]0UJ]0 CARRIER NAM' NRVLW W1RFI Fx5 ANLIGIInN OSIIFI6 RFV e tO RMARUFACTeIFR FNOIIKFRI'n FNIXAWpSINI:ORhMi/.rfn ]Dart I�n�e+l THIS REPORT WAS BASED ON A SPECIFIC ANTENNA AND COAX CONFIGURATION PROVIDED BY THE TOWER OWNER. ANY CHANGE TO THIS INFORMATION MUST BE REVIEWED BY FDH VELOCITEL. ALL CONSTRUCTION SHALL COMPLY WITH THE TIA-1019-A STANDARD Fa 0 VFI nrITF-I I ` CROWN CASTLE FIFIDFE551 CN9INEER 1 nRIROy —I IhM Oft pftr, ep—hmWo. OF report wtl ad by"Or —w T"b'w SUnOV` — I., I w a duly Lc"od P.f.blonal r -dM UM w— d" Sm. ofMIn o1a �D i9 D. A I Pan, Nona Sq—tu'. D.Ia /y.l IL LJQKA@0 41120 unsn5 uLNNu.J Hutt ✓! SHEETINDEX SHEET DESCRIPTION 111U SMU MWYIf.AINXJ W51)LC IION CIY.CRl151 REV. it 0 0 51 OF FRM NOTES 0 5� MOIJEIC — SI'.11FIJIJI F{ IWF I EVEL I AVOUT 0 So De)E F—STION WSTM i. AT10N IETM 51 0 Sb DFF F%TENSTION WSTAII ATq IJF TM 511 0 GuwN sr wn .Nkf.PYUYT ILLS Yv 1 ooA SUBMITTALS nR NOIIk1ArI0N FUN1AYAu M 1rl F<r O I nH :. Illy Y11n]lGi NIRYEk 16PXJY2400 r*C NAMC BEDDOR ENTERPRISES 878498 7700 QUATTRO CHANHASSEN, MN 55317 W?FI IIIIF TITLE SHEET S-1 MI CHECKLIST INSPECTIONS AND TESTING REQUIRED REPORT ITEM PRE -CONSTRUCTION x MI CH!(:M151 WGWIIO X LOKAWM WM x IAMHGIION IN51iLIAN x IAKMGIpI ClHIN LU WLW IN&1GIKN x 1MTFPoN TEST REPORT IMiq) x fMRIGTUP NrX N&KOTK)N N/A NGL RMNM I TM LIONEX l UASL IAAII X MxIITKMW TFSTNUMOINSPFCTIDNETE. CONSTRUCTION X CONSINUI:TgN MSI'LLI N)Nb N/A FOUMMTION MSPFClION6 N/A CLN(AFTF COMPRFSSNF STRENGTH ANU SI LIMP TFSTS N/A Vn8 I MS1ALLLU ANT-M KOV VLMFK:ATKN N/A BASL PLAT L GROII VLRIF K:AIION NIA LINIHN: IOK'S( —11FU WLLU I-- IKN MUNUL NLF'c1K 1. N/A LANTH WLB I AM)ULNWIV X ON SITE. 1OLU GLYMINIKNS NIA GU WINE *FNBKN REPORT x GC AS BUM I IK)GNFNTS A TIONAL ILSTING AND INSPLCIIOM POST -CONSTRUCTION X MI INSPLI:NMNLUUNLOKNO.OIlUUH ONE9N) N/A I —I M5I NLLU—MOR HON PULL I I LS IING X I'NO—NAi'FIS ADDITKINAI TFSTINO MOINSPF TK)NS NOIL', X UkNOI LS A UOCUMIFN I NLLULU POH INL PMI Rt PON I MA MNOTFS A DMUMFNT THAT IS NUT RFOURFD FOP TIIF PMI RFPORT MODIFICATION INSPECTION NOTES: GENERAL: IT IF MUDIFK:ATIOI INSPFCTIUN (MD IS A VISUAI INSPFCTKN OF TC WFR "SFFLATIUNS AND A HL VL W O CONS I RUC I ION NSPLC I1(NS ANU 0IHLN RLPOK I S TO LNSUHL T AIL INS I ALLA I KN WAS CONS I RUC I LU N ACCONUANCI, MIN [HE CON I RAC I UOCUMLNtS, NAMLLY I Hk MODIFICATION DRAWINGS, AS DFSK:NFO BY TIIF FN(ANFFR OF RFC(RD (FOR). IHL M IS 10 C.CNI NM INS]ALMA I ION COW IOLIRATKN AND WORKMANSHIP ONLY AND IS NO A REVIEW OF IHE MWUICAI ION DESIGN It SELF. NOR UOES IHE MO NSPLC ION IMk O WNIONSHIP OF THE MUDIFICATION OFSICN. UYVNFRSHR OF TKF STRUCTURN Mq)1FICATKN DFSK:N LI I LC I MNLS.S AND IN I LGHI IY RLSIDLS M IN I NL LOIN AT ALL ORALS ALL MFS SHALL ILL CONDLIC ILO UY A CROWN LNOINLLHING VLNU(R (ALE) ON LMRNLLNW(: SERVICE VENDOR (AESV) THAT IS APPROVED TO PERFORM ELEVATED WORK FOR CRT) WN SEE LNC•SIIL•I0173L51 O APPROVLDMVLN"S. TO IRACI IHIAI)HL NIO MIK:NISI IHE I AWE ME1,11 IVIIMIHAIIHk IINGl CON AS ION( IS RECEIVED. MI NSPLCI(N tlt THAT INL BE PROLLTIVE ING AS SOON IN A PO IS RECEIVED. R R EXPECTED THAT EAlH PARTY WILL BE PR CNII14 E IN YOUR CROWI10 OIIO CHNTPANIY.IFf,IN AC1 INPfRMAIKN6 N)I KNOWN. l;OxiIM:I YOUR CROWN POINT OF CONTACT (POC). RFFFR TO FNG•SU'N•IGUDT _. MODIFICATION INSPFCTKIN SOW OUR FURTIIFR DEIM SAND HEWNLMEN I S. MI INSPECTOR: THE MI NSPFCTUR W RFWPtFD TO CONTACT TIIF ( AS SOON AS RFCFN A PO F(R THE MI TO AT A MINIMUM: • HLVLW IHLHLQUNLMENISOI IHLMICHLCKLISI • WI)RK WITH THE GC TO DEVELOP A SCHEDULE TO CONDUCT ONSITE INSPECTIONS. INCH VDING FOUNDATION NSPFCTIOIS IHE MI IISPLC TOOK IS RESPONSIBLE FOH COLLET; I ING ALL OLNLNAL CON IRAL IOR (GC) INSPkC IION AND IkSI REPORTS. HIFVEWIHG I Ht DOCUM:N IS POi AIxh RIONCL 101MOO CONTRACT DOCUMENTS. CONDUCTING THE IN -FIELD NSPECTKRS, AND SUBMITTING THE NO RLPOR 110 CROWN. TI IF GC IS RFWIRFO TO CONTACT TIIF M INSPFCTOR AS SOON AS TLFCFfV"U A PO FOR TIIF MWIICA I ION INS] MLAI ION ON I URNI(EY PNOAC I 10. AT A MMMLMA'. • REVIEW THE REQURENENTS OF THE MI CHECKLIST • WORK WITH THEM INSPECTOR TO DEVELOP A SCHEDULE TO CONDUCT ON -SITE MOO W_1A IKIIOUNIAIKNINSPLCIKNS • BETTER UNDERSTAND ALL WSPECTION AND TESTNG REQUIREMENTS TI E GC SI1 PFRF(RM AN0 RECORD TIIF TFST AND NSPECTKN RFSUL TS IN ACgRDMK:F WITH INk NkUVINtMkN16O IRE MI CNECKLISI ANU kN68OV•1000T. RECOMMENDATIONS: I Ili EFFICIENCY AND EEFFECTIVENESS OONFSDMELUNE9RUIGNGGEA9M1KREPORT O.PEIttU IOkNHANfk NNE • IIISSIGGLSILUIRAI IH1_GCPNMIUL.AMl41MUM0l 5WISRILSESDAYSNDI1A, IRLFLKABLY W 10 IHL MI INSPOCIOH AS 10 WHION 111E Silk WILL HL READY POi THE M TO RF CONDUCTED. IHk GC8MMINSMCl(IRCO WR It CLOSELY1HNWGHMI 1111OLMNEPNOJkCI • WFENPOSSIBLO. IIISI'RLtEWtUIOHAVLIHk GC/8MIINSI'kCIMONSIIk SWUL TMEOUSI Y FOR MY WY W RF 7FN91OiNG OR RF•TFNSIONNO CPFMTIONS • II MAY tit tltNIFFICIAL 101NSI ALL ALL FO MHM(X*IGA I IONS PHIDN TO CCNOIC I NG I Hk FOO4MT10N WSPECTKNS TO ALLOW I WrDATIM AND M NSPECTIONIS) TO COMMENCE WAR ONE SITE VISIT. • WHION POSSIOILO, II IS VHtFk RR U IO HAVE IHt GC AND MI NSPLC IOt ON•S Ik UURNG THE MI TO HAVE ANY DEFICIENCIES CORRECTED DURING THE INITIAL M. THEREFORE. THE GC MAY CROC)SL 10 C0004 NAIL IPk MI CMLI ALLY 10 LNSINL ALL CONS I KLK;IION FN.ILITIE 5 nRE AT THEIR DISR»A'. WHEY THE MI11lYPEI' T' Hi IS ON SITE CANCELLATION OR DELAYS IN SCHEDULED MI: IT IHL GC MU M NSPLC RN AGRLL 10 A OAI L ON WHICH IHL M WILL OIL CONuUC I LU. MU EITHER PARTY CANCELS OR DELAYS, CROWN SHALL NOT BE RESPONSIBLE FOR ANY COSTS, FFFS. I CGS OF DEPOSITS MMUR OTT IFR PFNAI TIFS RFt ATFD TG TIE CANCFI I ATKIN OR ME AY NCURRtU BY Ell NON PAR/Y .OH MY I WE (t.G. INAVEL MU LODGING, COSTS O KLLINNG FOIIPMFNT ON-SITF. FTC.), IF CROWN CONTRACTS TMRFCTI Y FLR A THIRD PMTY MI. EXCTFP (IONS MAY BO MADE IN IHE LVkNT 1 HAI tH1FDELAYICMCkLGIO 1N IS CAUSED BY WkA1HLR ON OI HLR CMNIKNS IHA I WY COMIMIOMSt I Hk SMt I Y OF I HO PAN I IES IIVO,V M CORRECTION OF FAILING MI'S: R TIIF MOCAHI:ATK)N INSTA, I AT" WWI D FNI Ti IF M ('FM FD M") TIIF GC WIN 1 W(RK ENT III r,,HOWN IOCOI'*UINAILAkLMLUIAIK)NPLMNONLN IWOWAYS. • COHkLI;I I AILING LSSILS IO COMPLY MIN IHL SPLCII ICAIKN5(:ONIANLUINIHL ORIGINAL CONTRACT DOCUMENTS AND COORDINATE A SUPPLEMENT M. • CON WITH I:NOWN'S APPROVAL. IHL GC MAY WORK WAIN IHL LFM IO HL-ANKYLL IHL MOUIPIOAIION, Nk INPONC.k M1,NI USING IHLAS�bUILI CONDITION MI VERIFICATION INSPECTIONS: CNOWN Ht SLHV1,S IHE MGHI IOC,ONUUC.I A MI VEMPICAIKXI NSPECIIUN IO VkkIPY IHt A URAGYANDCLMIPLETENESSOFPREV"SLYCOMPLETEDMIWSPECTM(S)LNTCMIER MOOIFK;ATIOI PRU.IFCTS MI VLHII K;AIKN INSPLC IKNS SHALL UL NLLU IO INL SAML SPLCK K.AIKNS ANU PROFIESSIC IT REQUIREMENTS N THE CONTRACT DOCUMENTS AND IN ACCORDANCE WITH ENG-SWI IgWA&eby mrt VERIFICATION! WSPECTKIN MAY BE CONDUCTED BY AN INDEPENDENT AEVIAE SV FIRM F( {I MY P MOOIFKATION PROJECT IS COMPLETED AS MARKED BY THE DATE ()F AN MCEPTEU �(��jyplOn ) 'PASSING M•OL'PASSASN'OFE01101'RO1IPORIFt OOGIPALPRO1tCI PIatMMMIN Still. OI M n Print Nenw S)yMulo U9M .. %.) rL I REQUIRED PHOTOS: RFTWFFNTIIFO MOTIIFMINSPECTURTINEF(XIUWNCRKITLIUG l4S,ATAMIN 10 W. I MLN AND NC-13IN I FL MI RLPgt I • 1'Itt-CONSIKUCIK)NIiLNLIAL ItC.0NIMIION • PHOTOGRAPHS DURING THE REINFORCEMENT MODIFICATKTNCUNSTRUCTRIWEREI;TIT �4 MU NSPLC I ION •• RAW MATERIALS PHOI OS OF ALL (.HIT"- UL I AILS 1 WNUAIION MOMI ICAIIONS • WELD PREPARATKW UDLI N.SIALLAIION MU TCKWL •• FINALWS IALLkUCONUIIKN SURFACE COATING REPAIR ••POSI CONSIKUCIIDN PHOIOGNAPHS .. F INMINFILLOCONUIIKN PHOTOS OF ELEVATED MODIFICATIONS TAKEN FROM THE GROUND SHALL BE CONSIDERED NAMCKJAIL. I HIS RS NOI A COMPLLIL USI Ot NLOUNLD PHOI O.S, PLLASL ML1 LH 10 LNG41OW.1000T. w ® 'E�L,I. I CROWN CASTLE MGWNor wxl LIIkLKlU Ky KLS kNC. APWD LGA SUBMITTALS lgcu¢nIY�F�xw•lil �,wr x•wlrue rbl umlmcm n<w�IU.[ n�i AN•'P' •M1l�iF uiLlLraIIMAVANUF WIIquI IIt KKMFSO•p I IT4 ii•PRGRUNUMIIkN 16PXJY2400 BEDDOR ENTERPRISES 878498 7700 OUATTRO CHANHASSEN, MN 55317 BI kkT Illlk MODIFICATION INSPECTION CHECKLIST S EET NUMBER S-2 GENERAL NOTES: 1 ALL WORK SHALL UL UONL IN ACCOHOAPILL WITH ALL AWLN:AIJLL FLUkRAL, S IA I L ANU LOICAL CO)kS MU ONUNANCES- 11 IS I HE CONTRACTOR'S RFSPUNSIBII ITY TO OBTAIN AI 1. PERMITS NECESSARY 10 C,OMPIk I k I Hit PROIL.0 I AND MILE By ALL CONUIIONSANUNkWIHkMkNISOF IHLI'LKMIIS. 1 THE CONTRACTOR SHALL BE RESPONSIBLE FOR VERIFICATION OF ALL UML NSKNS. LLLVA I IONS ANU LASI NO CONDITIONS A I IHL SIIEBk OkEMULNINGMYMAItMALSORDOINGANY WORK. NO FXTRACILMR FORCLMPFNSATINSIWI RFA.IUWFnWFTU UIF FtkkW.k Ut I WLLN AC IUAL UIMLNSKMS MU UWNSICNS INLMCAMU ON 1 Hk CONSINUCIIN UHAWINGS. ANY SUCH DISCRFPANCY N nIMFNSIN WHICI I MAY RF FOUND SOW I RF SUUMII ILU 1O FUH VLLOCIILL FOAL CMSDtRAIIGN BtFO k IHE CONTRACTOR PROCEEDS WITH THE WORK IN THE AFFECTED AREAS. J NCURRFCTI Y FAIIRIATFD. DAMAGED OTHFRWISF MISFITTNG, OR NON -CONFORMING MA I LHIALS AND C,ONUI I IONS SHALL BE FALPOH (kU I o FUH VkLOC11kL ONION I O ANY HLMEUTAL OO CORRFCTIVFACTIUN. NI ACTIUNSSIINI RFWIRFFDIIVEIOM;ITFI AR'XOVAL, A II IS IFR:CONINACIDIRSSOLk NESP(NSMIJIY IODLIENMINL FRECTKN PRWFDURf AND SRJUFNGF TO FNSURF TIIF SAFFTY OF IHL SI MUC I UKL ANU 11 S C,OMPON N I PAk I S UUKING LKLC.I DN ANIL01(FILLU MOIUI:A I INS. I HIS INL-LUM& BU I IS NOI LIRA I LU TO. TIIF AOOITION OF TFMPURARY RFtWWi, WYS LN TF M)WNS I INI MAY BE NE C tSSMY. SUCH MAI tHIAL SHALL tlE HkMOVkU AFIt11IHk CCMPU:MONDE IHEINOACI. N WNTRACTOR SPIN I PROMPT[ Y REMOVE ANY & Al l DEBRIS FRLM SO I L AND RLS IDYL AS BLS I AS POSSGLL 10 PHLCON51 RUC I ION CONDITION. 6 ALLCONSTRUCTGN MEANSANDMETHOOS. INCLUDING BUT NOT LMI I LU 10 LRLC I ION PLANS, RIGGING PLANS, CLNNNG PLANS, ANU RESCUE PLANS SHALL BE THE RESPONSIBILITY OF THE GENERAL CONTRACTOR RESPONSIBLE FOR THE EMECUTKINOF THE WORK (:ONIMNLU HLRLIN ANU SHALL MILL I MSVI IA 1019 (LAI LSI LUTKN). WHA. AND GENERAL INDUSTRY STANDARDS. ALL RIGGING PLANS W W 1 ADI IFRF TO ANSVTW IU19 C ATFST FDITI(ON) INCI DOING D1F HLOUNLU INVOLVEMIN I O A OVALRIW LNGNLLK P0N CLASS N UONSTRUCTION THE CLIMBING FACILITIES, SAFETY CLIMB AND ALL PARTS THEREOF SHALL NO UL IMPLULU, MOUR OLD ON AL ILHLU WIIHOU I IHL EXPRESS WRITTEN APPROVAL Of THE ENGINEER O RECORD 6 ANY WORK PERFORMED WITHOUT A PREFABRICATION MAPPING IS MINE AT IHL RISK O THE OTC MMOH FABRIGAION. CONTRACTOR QUALIFICATION NOTES: 1 ALL REPAIRS SHALL BE PERFORMED BY A TOWER CONTRACTOR WITH A MINIMUM 5 YEARS E XPERIENCE IN TOWER ERECTION AND RETROFIT ANTIW11HW(INKINGKNOWLLU01-01 IML MSVIIMl[S c; 'SIRU(:TURALSTMUMUF(NANTENNASUPPORTINGSTRL ,TUBES ANU M I LNNAS" 1 —1 I RAI N (N IS HLSRNSINLL ION ALL GUNS I RUC I IOW MLAN5 AND ME FOODS SHOULD THE COWRACIORREOUNE DIRECT UI INSUITATDN. FDH VELOCITEL IS WILLING TO OFFER SERVICES UASLU UPON M A GHLLU 1 ILL 1 ON IFI WONT( HLOOHLD. 1 ALL SUUMII IA. INFORMAI ION MUS I UE SEN I IO FUH VkLOCI ILL WI MFRMIFN DRIVF RAI FIGII NC 17616, TFI (919) T56-1011. FAX. (919) —1IJI t-MAIL S I HUC IINAL{p' FUHVkLOC1ILL C(M. MY VAIN I ION OF THESE SPECIFICATIONS OR DRAWINGS WITHOUT CONSENT FROM FDH VELOCITEL WILL VOID ANY RESPONSIBLY OR LWIILRY FOR UMIAGL (MAI LMIAL ON PHYSWAL) I MMUS 1 ON VLLM:II LL X ALL C(NSIRUI:IHON I()Bk INACC,O NC! WIIH IHE IIA-IUI?A STANDARD JOB SITE SAFETY 6 NOTES: NEI I Ht1O I HE 1'IOOFLSSMNAL AC I NI P WS (W FUH VLLOCI I kL NON I Ht PRESENCE 0" FDH VELOCITEL OR EMPLOYEES AND SUB -CONSULTANTS AT THE CONSTRUCTION SITE, SHALL RELIEVE THE GENE HAL I ON I HAC IRA( AND U( SUBCON I IOC IOOS AND MY 01 HER ENTITY (TIF THEIR OBLIGATIONS. DUTIES AND RESPONSIBLLITIES INCLUDING, LOU I NO) LIMI I LU 10. CONS] HUl.I ION MLMS, ML I HODS, SEQUENCE. TECHNIQUES OR PROCEDURES NECESSARY FOR PFRFORMING, SUPf RINTFNnING OR COORDINATING Al I RATIONS I A IHL WORK M C.DNS I KU .I I N N AC.C,ORUMICL WIIH I HL �;ONTRACT OOCUMENTS AND MY HEALTH OR SAFETY PRECAUTIONS RFMNRFD BY MY FGUI ATOiY AGFNI:FS. TINE GFNFRAI I.(NI NIMAC I OH ANU OO SUBCON I NAC I ON IS SOLELY RESPONSIBLE (IN JDRUM" MDWMRANTSTIATTNISNTFNTISFVEMNTRY AUCEPTINO THIS W(MK STEEL: 1. All UTRWTURAI STFFI SOW RFFMRICATFOMOFRFCTFn1N ACCMUANCL WI I H I Hk LAI tS I AISC CODE MU AS I M SPFCFI:ATI(ONS. I. ALLCONNLCIIONSLA SIkII(:IUHALSILL.MLMULKSSNALLULMAUL USINGSPLCIIILUWLLUSWIIHV LUNGLLLCIk(DLSNUILUINIHL STEEL GRADE SCHEDULE OR SPECIFIED HIGH STRENGTH BOLTS TO SL AS IM A32514, I HHLAD INCLODILD WI IH SHLAR PLANE (UNLESS OINEHW19t WILD) J. ALL BOLTED CONNECTIONS TO BE INSTALLED TOASNUG-TIGHTENED CONUIIAMI N ACCORUANCk WIIH ALSO 1J PAkI 16,1.'31"ECIFI'A TIN I OR S I KUC I URAL JOIN IS USING AS I M AJZ6 ON — WX I S- SECT" 6.1. UNLESS OTHERWISE SPECIFIED. WHEN'r TYPE BOLTS ANL USLU, C(NINAC ION MAY UL kLo UlHLU 10 SIM:K AUUIINONAL WASHERS IODBIAMPHOPEk SNUG IGHI INS14LAIKA ALLNUIS SI W I RF 11FAW I IFX UNI FSS OTIIFRWISF NOTFn A. ALL SI EEL. AP ILH F"HICAI ION, SHALTSL HU I DIPPED GALVANIZED PLN AS I A-IZJ. ALL UAMAOL U St Oki Al. L S. WI, LUX U ARLAS ANU ALIT HORIZED NON -GALVANIZED MEMBERS (N PARTS (E AS TING OR NL W ) SHALL UL PAN OLD WIIH MOIL I'LL 1:('A 1 S HI ZHC CMU GALVANMNO C(MPM)NU ACHtIVING A MNIMUM OF + MILS URY FILM PFR ASTM A — 5 ALL SHOW AND FIELD WELDING SHALL BE DUNE BI WELDERS OUALIPR:U AS DESCRIBED N I HE'AMERI AN WELDING SOCIE I Y'S STANDARD QUALIFICATION PROCEDURE* TO PERFORM THE TYPE OF WORK HLUINLO. CON I FDIC ION IS RLOIINLU 10 PROVIUL I Uk VELOCDEL WITH A PASSING CERTIFIED WELDING INSPECTION FOR NI WFI nS 6 STRUCTURAL STEEL MAY NOT BE TORCH CUT FOR FABRICATION A- S I EEL F MINICA I ION MUS I Pnll(MV MSC, S IANUARDS. MISC. NOTES: 1 ALL MODFICADCNS ARE ASSUMED TO BE MADE ON AN EMPTY I OWLH I:ONI HAC.IOH IS HL.IP(NSMLL In MAILL PHOVISIOIS IO SUPRMI (N WORK AROUNL' EXISHNG ANT ENNAS AND TRANSMISSION I NFS MODIFN.AINNS MUTT RF CUNTINUUUS THROUGH ALL AHLAS SHOWN 1 CONI HA(: 1014 HELD VENIFY ALL UIMLNSK)NSl ROM 10 CONSTRUCTION FABRICATION NOTES: 1 ALL UMLNSKNIS AHL PHLLIMINMY TIN I It I ILU VLHII LU UY C(NTRACTOR ANY CHANGES MUST BE APPROVED BY ENGINEER OF IILCONU N WHIIING PHIOI IO I AUHN:AIION ANU NSIAL.AIION. 1. NkWSIELL MkMSLHSMUST HAVLSINULL UNILLWROLLS. SLOIIED ANU UM)BLk UIILLEU HOLLS AI(k W I ACCtPIABLk MEANS OF FABRICATION SUBSTITUTES AND/OR EQUALS: 1 If CON I HAC.I OH WISHL S I0. IINNISH fN IISL A SNUB 111111 L I ILM O MATERIAL OR EQUIPMENT, CONTRACTOR SHALL FIRST MAKE WHII I LN APPLICA I ION 10 LN(iMLK M KLCOHU 1 ON ACCLPI ANCL IHEkLOP, CER111,YING THAT 1HE PROP OSEU SUBSTITUTE PALL PFRF(NM AIF WAM 1 THE FUNCTIONS AND AGNIFVF THE RFSUI TS C.ALLLU I ON UY IHL OLNLNAL OLSIGN. UL SIMILAR IN SUDS I ANCL TO THAT SPECIFIED AND SUITED TO THE SAME USE AS THAT SPECIFIED Al I VARIATIONS OF TIIF PRUPUSFD WRSTITUIF FROM THAT SPECIFIED WILL SE DkN I PILU N IHE AR'LICAI KN AND AVAILASLE MANTFNANCF "PAR AND RFR AGFMFNT SFRVIGF WI I RF INDICATED THE APPL"TION WILL ALSO CONTAIN M ITEMIZED LSI NM I E OF ALL f,0515 Oil GlItUII S IMAI WILL NLSUL I UNLC, I LY ORION RFCTI Y FRUM ACCFPTMCF OF WCII WRSTITUTF NOI LK*F, COS I S OF REDESIGN AND CLAMS OF OIHLN CONI RAC T ORS L,—SIDED tlY IHE I(LSUL I OF RECORD ALL EVALUATION WHICH WILL UE CONSIDERED UENGINEER OF RECORD DO NCOikD MTKN OF THE CONTRACTPOS ORTOI URN[ LADDITI NA DATAA OUT HE MINL CONTRACTOR TO FURNISH ADDITIONAL DATA ABOUT TILL PROPOSED SOUSIU111L COLD GALVANIZATIONISURFACE PREPARATION NOTES: 1 CONIPAI 1— Ir. —LCINGAOKZHCCMUGALVANICAIKN CUMPUINOS UR APPR(NFD FUUNAI FNT 1 FNLPA HIISILIIK:(x(NULILUSUHIACLILNIXLAIMLNI ACC,OHUNG 10 MMUI AC IUNLX'S HLC.nMMLNUAI KNS. 1 CONTRACIO(IOAP11Y(1)C.OAISOF C.MUGALVANIZAIKN COMPOUND PER MANUFACTURER'S RELLSAMENDATION. DRYING ANUCURING TIMES MUST BE UIILMtU I'LH NANUPAC IUIILH'S RECOMMENDATION A. APR A.I COATINGS BY RRUSII IN LAI M WIND C(NIMTI(NS. I HE USE OP AEROSOL IS NO PEKMI I I tU 5. IF IHE 10WLHISPAINIE0, BHUSHPANI ALL IRLAILDAREAS TO MATCH TOWER AFTER COLD GALVANIZATION COMPOUND IS ALLOWLU 10 C RL SAFETY CLIMB NOTES: CON[ MAC ION 10 INS I AU. IUF-I UG CAULt WE CLIMB SYS I tM UNLESS OTHERWISE NOTED, USE OF A SUBSTITUTE GILL! SYSTEM IS ACCFPTAM F. C(NTRACTUR SO W I FIRST MAKF WRITTEN API'.GAI ION TO ENGINEER OP KtCONU FOR ACCLP IANC,k I NINEOP CFRTIFYNG TIIAT TO IF PRUPUSFD SUBSTITUTF WE I PERFORM ADE WATLY THE FUNCTIONS AND ACHIEVE THE RESULTS CALLED PON BY IHE GENERAL DESIGN. Z. NEW TUF-TUG CABLE SAFE CLIMB SYSTEM AND ASSOCIATED I IARDWARF SO IOU D BF RMCI WSFO OIRFCTI Y FROM TIIF MANUFAC I UHEN PO N I OF COY I AC 1 LIS ILU UkLOW AND INS IALLLU PFR MMUFACTURFR RFCC&OWNTATINS JOEYDEUER 1 OF I UG ISNJUA:I S 1A JX FWRFTF IANF MOKANk, OH A A PHONE: (91112911,12111 FAA MIT 211,11 1Z0 WLUSI I LW W W.IUF-I IG.COM EMAIL. TUFTUGAWX COM STEEL GRADE SCHEDULE SCOPE SHAPE GRADE YIELD STRENGTH (Fy) ULTIMATE STRENGTH (F ) MDNF(MTTXTTNSNIN PFT ASJ GRI J5I91 40 KNI ALL FLAIL Ab WMSI ALL WLLU LLLC I HUM. LAUAX - WK61 PROFESS[ 1 HAFBDy -,I ,.r"t Y La NI'(10(VINM'D RdeNflcxld 1'. Stet. DI M n Pml Hen e S.AnMwa. Data It -IF VELOCITEL CROWN CASTLE AWWN BY W. !.IIkCXlU tlY KLy Fr.c APrvu 1xu Bf®®D37 ®�Q �-Bl AV 10 TOWER ELEVATION SCMF Ht MANUFACTURER POLE SPECIFICATIONS POLE SHAPE "PE, ROWED — TAPER B IBBieI INIFT SHAFT STEEL. ABIMAST] GRADE N BASE PLATE STEEL. M71-M IN KS) ANCHOR HOUS 21110B1Bl ASTMABIBGRADEM MANUFACTURER SHAFT SECTION DATA SHAFT SECTION SECTION LENGTH (FT) PLATE THICKNESS (IN) LAP SPLICE (IN) DIAMETER ACROSS FLATS (IN) (STOP @BOTTOM ]1.4e DRUS 1a Wtt! to e]e iB IXN S Alb on III- Ie SnO N07E'. DIMENSIONS SHOWN DO NOT INCLUDE GALVANMINO TOLERANCES TOWER MODIFICATION SCHEDULE NO. TYPE OF MODIFICATION BTM. ELEV. TOP ELEV. SHEET 1 INSTALLATION OF NEW MONOPOLE EXTENSION e1.0't SY.CF e^e TO 84 2 IIBTALLAIIONOFNEWSAFEIYCLIMB TM-IUGPMITCSCS Ltdt M.It CONTRACTOR U. VERIFY ALL APPURTENANCE CONUI KTNS AND DIMENSIONS IN RELATIONSHIP 10 THIS MODIFICATION. APPURTENANCES MAY NEED TO SE TEMPORARILY REMOVED OR MOI DURING THE INSTALLATION OF THIS MODIFICATION CON tRACTON SOW IMMED41TkLY REPORT ANY AND ALL OSCHLPANCES 10 THE EON AND CROWN CAS ILL PRIOR IO PROCEEDING AT I H THE WORK ALLMOUWIOAIIONSIOBEINSIALLEDL'ONIINUWSLYTHHOUGHEXISIINGEWWMENI ALLLXISIINGEUUIPMFNI NOT TO BE DAMAGED OR TAXEN OFF AIN DURING INSTALLATION SEE SIRUCTURAL ANOI HtPORt FUN LXISTINU MIEN" LOADING SHIMS FOR MONWI L REINF( GLMLNT MEMBERS SHILLI. BE HEUUIRkL)WHtRE GAPS BEI WEEN IHE POLL SHAD I MG REINFORCING MEMBER EXIST AT FASTENER LOCATIONS. FOR INIERMEUTAIE CONNECTIONS. THE MINIMUM SHIM LLNGIH MID WIDTH SHALL BL IHL WIU IH OF IRE RkINFOiCING MkMILLR FOR ILNMMIAIION CONNECTIONS, A C. MNITNUMS SHIM PLATE (PREFERRED)ON EOUIVALENI INDIVIDUAL SHIM PLATES. MATCHING THE WIDTH OF THE REINFORCING MEMBER MAYBE USED SHIM THICKNESS SHALL BE NO LESS THAN VIS'. STACKING OF SHIMS IS PERMITTED FINGER SHIMS AND HONSLSHOL SHIMS ARE PERMIT IkG SfACKkU 6NIMS 9HM.L tlF NO GNkATLN INAN 114- WIIHW I EON APPROVAL FON PLAIES SIARIMO AI C'. IHL BOI TUM OF THE FLAT PLAIL SHALL BLGIN AI e" 11- FOR SINGLE PLATES OR WLTIPLL FLAILS SPLICED TOMEIHER, THE BUT TOM OF THE FLAT PLATE RUN SHALL BEGIN AT IRE PROPOSED ELEVATION 1 B' FOR MUL I IPLE PLATES SKICLU TOSE IHLR, THE IOP CIF THE FLAT PLATE IS ID BE PLACED SUCH 7MAT THERE 15 NO MORE TWIN ]' DIFFERENCE BETWEEN THE ACTUAL OVERALL LENGTH OF THE SPMN MID THE PROPOSLO OVERALL LEND IH OF THE SPAN. FROM THE BOT TOM OF THE 007 TOM PLATE 10 THE TOP OF THE TOP PLATE PRIOR TO FABRICATION AND INSTALLATION. CONTRACTOR SHALL FIELD VERIFY ALL LENGTHS AND WANTRIES GIVEN LENGTH AND DUMMIES PROVIDED ME FOR 000I ING PURPOSES ONLY, AND SHALL NOT BE USED FOR FABRICAI ION (INSi ALLEU1 ' (0J 14N"10 e6Fl LEVEL BASE LEVEL LAYOUT SCALE: NTS (PILUPOSEU) (211-I? TO e0 FT LEV L i VELDCXTEL CROWN CASTLE PHOF9551. L EN01NEE8 I hereby IAe1 WA PIAII, BPeeNnMIXL n ,eP:.n Wn eG by IX undON r"d d IMI I — B GDIy L4CeDB d I"'+ gfret 1NIIder Br levee d 81e S w. Dl MII p,„T e Dennis D. Abel N_ t 41120 Lxe , fl-11% 21YIfi D AIK.L. FL DRAWN BY WJD CHECKED BY OILS Eno APP/D DOA SUBMITTALS IIttNPTbe KBY 4 Fpl VF -- PRO—T II1A®L 16PXJY2400 BEDDOR ENTERPRISES IH E Nt,MRLR 878498 III F A.-F88 7700 QUATTRO CHANHASSEN, MN 55317 SHEET TIT1E MODIFICATION SCHEDULE A BASE LEVEL LAYOUT 5IIEE7 NUMBER S-4 PE., (3) NE W 1 110-O FLANOE BOLTS NEW PWE EXTENSION. SEE —. SHEET S-0 FOR DETAILS WITH NU TS A LOCX WASHERS ON A 1' TO B.0 - __________ TOP OF EXTENSKN� &6 NEW NEW SAFETY LIKE PLATE. NEW 9ThPBDLT/ SUHEUTAE FUR DE TAILSAItfi _ _ ___ A _ SEE MATERIAL SCHEDULE ON IT VPJ \ g_p 8.8 SHEET SA FOR DE TAR 6. 2 BLP-, NEW SAF E TY LINE PLATE. PET SEE MATERIAL. SCHEDULE ON NEW PIPE EXTENSION SEE SHEE I S-6 FOR DETAILS. SHEET ^ S FOR UE TAILS STEP BOLT INSTALLATION SECTION VIEW C.L. PORTHOLE ELEV'. 417-11 Wrt '2-' SECTION S-5 SCALE:NTS PE 1 NEW L) 112) NEW I IM-0 FLANGE BOI. IS -WHHNUtS&LO0KW"HkRS NEW STEPBOLT. SEE PIPE 6.EE18EFpOP �`E DETAES 'Lef ,/•1 {yam ONAI'.TOB.0 - THIS SHEET FOR DETAILS (TYP.) � lLJ7 NEW STEP BOLT. SEE SCHEDULE FOR DETAILS. (TYP ) NEW FLANGE PLATE. SEE BEE - 9HEE 194 FOR DETAILS. PIPE EXTENSION LAYOUT SECTION VIEW a SECTION C.L. PORTHOLE ,-h S3 SCALE;NTS ELEV'. 77.11 lira PE-1 /NEW POPE EXTENSION SEE SHEET S-6 FOR DETAILS (2) NEW 518V HEX NUTS /• NEW LIB"0. r (12) NEW 1 IM-0 FI ANGF NOI TS ' STEP BOLT V rOTS 8 LOCK WA9MEN5 ON A - I ON A NUf. _ATM. OF_EXTENSION .., ,.._ ELEV 57'.O't � SBS-1 EXISTING MONOPOLE �- NEW STEP SOL T BRACKET SEE SHEET S-6 FOR DETAILS PIPE EXTENSION INSTALLATION STEP BOLT INSTALLATION ELEVATION VIEW PLAN VIEW f/ ;�—`}E__LE_VATION , DETAIL \, S-5 / SCALE: NTS S-5 SCALE:NTS PIPE EXTENSION MATERIAL SCHEDULE PART p QUANTITY DESCRIPTION PE1 I PIPE EXTENSXIN 1b 11AY0 AWSN FLANGE Bd.T W/ NUT 8 LOCK WASHERS lS L1'0•TSTkPbdl M "'0 HEX NUT TUi'1W TTCBCS SAFELY CLM6 SYSTEM • CONTRACTOR TO REPLACE SAFETY CLIMB CABLE. ONE CONTINUOUS CABLE IS REQUIRED FROM TOP OF EXTENSION TO BASE OF TOWER. SEE MATERIAL SCHEDULE FOR DETAILS. • INSTALL EXTENSION WITH STEP PEGS IN LINE WITH EXISTING STEP PEGS. • CONTRACTOR TO REMOVE AND REPLACE EXISTING LIGHTNING ROD. REPLACEMENT LIGHTNING ROD TO BE PLACED AT TOP OF EXTENSION. • CONTRACTOR TO PERFORM SITE VISIT PRIOR TO ORDERING MATERIALS TO VERIFY ANY INSTALLATION INTERFERENCES. PROFESSI 1N by Typal wHm EupdvlfHbll PHnr did l� Stone Of M Pnnt Nww SrunNum DS18 1 Lit 2110113111111 \/EL0CTTEL CROWN CASTLE OR/AYM SY __. WA) CI.OMEOIN, as ENOAFnM _ OW BLIW TALS wEdIICN XEY CWSiMKiXw S PE., NEW PIPE EXTENSION. FDN -OCI— 111pJEGT NLAlER SEE s8 FOR DETAILS. �\ 16PXJY2400 aP-, NEW SAFL IY LINE PLATE. SEE MATERIAL SCHEDULE ON 1\ SHEET 36 FOR DETAILS. Ir nnNr BEDDOR ENTERPRISES 3 O gig— sItLN MukR 878498 ,yr tXiM LE/I jf YS HOLE sNl S� 7700 QUATTRO USE MIN CHANHASSEN, MN 55317 _ EDGE DISTANCE OF 1 5 TNES 4- HOLE DIA SNkEI Tlllf (TYP) PIPE EXTENSION INSTALLATION DETAILS I SAFETY LINE PLATE DRILL DETAIL ELEVATION VIEW _ '/ 5 \ DETAIL NlR•EN eSKEET S•5 SCALE: NTS S-5 I r-j—, ram_ ---1'•70 trr --I I V EACH lVV7 \ETCH END) a,e 7 SPACES o X4r - 1r-r (TYP.) `BBB•1 - P-1 ITYP.I 7 SPACES 0 7-e• • 17'fi' PIPE EXTENSION SIDE VIEW DETAIL S•S SCALE:NTS MATERIAL LIST (PE-1) PART # CITY. DESCRIPTION R1 1 HAW 1/1 (14 0. O 0)• 19-W LONG IP.1 T FLANDE PLATE CFI 1 CAP RAZE e/e-1 1/ BTEPBOIJII ET eV-, , SAFELY LNF PLATE IIH 1Qie'W'I PMI E PORTHOLE - SABRE PM Lt01t 101 prP.) / y,eV CP-1 , CONTRACTOR TO FIELD VERIFY LOCATION OF PROPOSED EX1EN910N PRIOR iO-1ERIAl ONI1ERS AND FABRICATION. FP•1-. t. — DIMENSIONS ARE PHELIMPIANY UN T. FIELD VERIFIED BY E<P., /• CONTRACTOR ANY CHANGES MUST BE APPROVED BY ENO INEEH OF NECORD W WNI I ING P 1011 10 FABRICATION AND INSTALLATION \ PEEL I YPT ie � 4- PN•1 - e NEW P(A01",HOLWI HELIUM NOpLe. SEE ,'•lr— - ,.IS SHEET FOR DETALS. — r - ---I MIP) I_ F1 FW PIPE � / OPH.,NEW SABRE PONTHZ (-o O SEE MATERIAL I.W A (t) NEW SABRE VELLUM NOOKS PER O 0 - \ �� (INGI.UDEU IN PORTHOLE PM C04106101) O � iiP ! 1 yr (IYPJ NEW SAFETY CLIMB -� 1-- +• PRATE �� NOLEe SEF SCHEDUI F ON m.P) ON A I'-ri ON A 1'•,"0 B.0 SHEET 5 11. UE TAILS PIPF FXTENSION INSTALLATION PORTHOLE INSTALLATION LAYOUT FLANGE PLATE SECTION VIEW SECTION VIEW PLAN VIEW SECTION z DETAIL FP-1 DETAIL_ :.° SCALE: NTS SCALE: NTS S4SCALE:NTS 111r VEL Mr-- CROWN CASTLE DPAWN BY WJD �.nlmAFu ur KLS 1.1; AU 10 OOA SUBMITTALS -- PVIgF I!V ,]o• °oo�w:nE:FAo:.:rr"�iY�v P;��xE w..wauuelw 1 \ i I rpl vLl U..i1F �Noir�r nuNBeN �r 16PXJY2400 ,IHrO 110LEFgi ,M'TNM STEP BOLT PLATE — ...,n NBEDDOR ENTERPRISES HM• THICK _ \. '�� 878498 PLATE 011e•D r _ ON OH A t••7'B B SC C SITE —EBB 7700 QUATTRO CHANHASSEN, MN 55317 CAP PLATE STEP SOLT BRACKET PLAN VIEW FRONT & TOP VIEW cP•, DETAIL see•, DETAIL E E E TITLE PIPE EXTENSION 8•S SCALE: NTS S-6 SCALE: NTS INSTALLATION DETAILS II —11 NUrNLEn S-6